Details for Lyrate rockcress Locus 16036543

Position : sca5 ( 5`- 18022934 .. 18014317 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036543

Protein [Map View]
MMKRGREENCHETSPSPKRLLHGGVIDIPLDLTVEILKKLPAKSLVRFQCVSKLWSSIISSRRDFIESIVTRSLTQPPRD
AHFIFDVAPGPYVECFLALSSTCPPNTDIEAEISMPGRLGQYVRGLICCFSGLKLKTIGSRLVKFSRWEIPRRSSGGNSK
VLDLITLHLKDAEKETQGWSRIFFYEMHGFSNWRLLGATRGGEIVFGELRYRLYNEKLLRVLYYDPKLNSMRYVDLEGTL
PKDRRRYDFTSI*

DNA
ATGATGAAGAGAGGACGCGAAGAGAATTGCCATGAGACCTCACCCTCGCCGAAACGACTTCTTCACGGCGGAGTTATTGA
TATTCCTCTGGATCTGACCGTAGAGATACTAAAAAAACTCCCGGCGAAATCTCTAGTGAGGTTCCAATGTGTGTCGAAGC
TGTGGTCATCCATTATCAGCAGTCGTAGAGACTTCATAGAGTCGATAGTCACTCGATCTCTGACTCAGCCTCCTCGTGAT
GCCCATTTCATCTTCGACGTCGCTCCAGGCCCCTACGTGGAATGTTTCTTAGCCTTGTCGTCTACTTGCCCTCCAAATAC
TGACATAGAAGCAGAAATATCAATGCCTGGGAGATTGGGGCAATACGTTCGCGGCTTGATTTGTTGTTTCTCTGGTTTGA
AGTTGAAGACTATAGGAAGCAGGCTTGTCAAGTTTTCACGTTGGGAGATCCCAAGACGAAGCAGTGGAGGAAACTCCAAG
GTGTTGGATCTCATCACGTTACATTTGAAGGATGCTGAGAAGGAGACACAAGGATGGTCCAGGATTTTCTTTTACGAGAT
GCATGGCTTTTCAAATTGGCGCCTCTTGGGTGCTACTCGTGGTGGTGAGATCGTTTTTGGCGAGTTGAGGTACAGGCTCT
ATAACGAAAAGTTGTTACGTGTCTTATATTATGATCCGAAGCTAAACAGTATGAGGTATGTTGACCTCGAAGGTACTTTA
CCCAAGGATAGAAGGCGTTACGACTTTACTTCAATATGA