Details for Lyrate rockcress Locus 16036542

Position : sca3 ( 5`- 6495048 .. 6493911 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036542

Protein [Map View]
MASKIVVIIVFILDLIAVGLAIAAEQRRSVGKVETDREKQYEYCVYGTDIATSYGAGAFVLLFVSQVLIMVASRCFCCGK
SLNPGGSRACAIILFLICWVFFLIAEMCLLAASIRNAYHTQYRKMWNVEDPPSCEVIRKGVFAAGAAFTLFTAIVSQFYY
VCYSRARDAYQNPSY*

DNA
ATGGCTTCGAAGATTGTAGTTATAATCGTGTTTATCCTCGATCTCATCGCCGTAGGATTAGCCATTGCCGCCGAGCAGAG
AAGAAGTGTCGGCAAGGTTGAAACGGATAGAGAGAAGCAATATGAGTACTGTGTTTATGGTACTGACATTGCTACAAGCT
ATGGAGCTGGTGCATTTGTTCTTCTCTTTGTAAGCCAAGTCCTTATTATGGTTGCTAGTCGTTGCTTCTGCTGTGGGAAG
TCCCTTAACCCAGGCGGTTCAAGAGCTTGTGCCATTATTCTCTTCCTCATTTGCTGGGTGTTTTTCTTGATCGCTGAGAT
GTGTTTGCTAGCGGCATCAATCAGAAACGCGTACCACACACAGTATAGAAAGATGTGGAACGTTGAAGATCCACCAAGCT
GTGAAGTTATAAGGAAAGGAGTTTTTGCAGCTGGTGCTGCATTCACACTCTTCACCGCCATTGTCTCTCAGTTCTACTAT
GTTTGCTACTCTCGTGCTAGAGATGCTTACCAGAATCCTTCCTACTAG