Details for Lyrate rockcress Locus 16036527

Position : sca3 ( 5`- 5090302 .. 5089016 -3` )
Annotation : [B2G] methyladenine glycosylase family protein
External links : CoGe
PGDD synteny : 16036527

Protein [Map View]
MSKTEAISLTKRGMLPPSSCSSLMDRSESLKRDSVMSNGAAKVRGSLERKKSKSFKEGESYSSWLITEAPGSIAAVRREQ
VAAQQALRKLKIAHYGRSKSTINFTSSKVVPLLHPNPNPHPQRCSFLTPTSDPIYVAYHDEEWGVPVHDDKTLFELLTLS
GAQVGSDWTSTLRKRHDYRKAFMEFEAEAVTKLTEKEMNAISIEYKIDMSKVRGVVENATKIVEIKKAFGSLEKYLWGFV
NHKPISTNYKMGHKIPVKTSKSESISKDMVRRGFRFVGPTVVHSFMQAAGLTNDHLITCCRHTPCTILATNP*

DNA
ATGAGCAAAACCGAAGCAATAAGCTTGACCAAAAGGGGAATGTTGCCGCCAAGTAGTTGCAGTAGCCTAATGGACCGCTC
TGAGTCCCTCAAGAGGGACAGTGTGATGAGCAATGGTGCAGCCAAAGTGAGAGGAAGCTTGGAGCGCAAGAAATCAAAGA
GTTTTAAGGAAGGAGAAAGCTATTCTTCTTGGCTCATAACGGAGGCTCCTGGGAGTATAGCCGCCGTGAGGAGAGAGCAA
GTGGCGGCACAACAAGCCCTAAGGAAGCTAAAGATTGCTCATTACGGCAGATCCAAATCAACCATTAATTTCACTTCTTC
CAAAGTCGTCCCTCTTCTTCACCCTAACCCTAACCCTCATCCTCAGAGATGCAGCTTCCTCACCCCCACTTCTGATCCTA
TTTACGTGGCCTACCATGATGAAGAATGGGGAGTTCCAGTTCATGATGACAAGACGTTGTTCGAACTGCTGACCCTAAGC
GGCGCACAAGTAGGCTCCGATTGGACTTCAACCTTGAGAAAACGTCATGACTATAGGAAGGCTTTTATGGAGTTTGAGGC
GGAAGCTGTTACCAAACTCACCGAGAAAGAGATGAATGCAATAAGCATCGAATACAAGATAGATATGAGCAAAGTGAGAG
GTGTTGTGGAGAATGCTACAAAGATTGTCGAGATCAAGAAAGCGTTTGGGTCATTAGAGAAATACCTTTGGGGATTTGTG
AACCACAAGCCCATCTCCACGAACTACAAGATGGGACACAAGATTCCGGTCAAGACATCGAAGTCGGAGAGCATAAGCAA
AGACATGGTTCGTAGAGGCTTCCGGTTTGTGGGTCCCACTGTGGTTCACTCATTCATGCAAGCCGCTGGTCTTACTAACG
ACCACTTAATCACTTGCTGTCGCCACACTCCTTGCACTATCCTTGCTACCAATCCCTAA