Details for Lyrate rockcress Locus 16036519

Position : sca3 ( 5`- 2057213 .. 2057782 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036519

Protein [Map View]
MKNVSFQLLLLVSLLVLVFRHDLVEGRTMHTNRGSGDYHDHPCNPSDPKCDKPCNPENPNCRMKQGVIEPNRGNGYLHDD
PPCNPNDPKCDKPCDPENPNC*

DNA
ATGAAGAACGTTTCCTTTCAACTTTTGTTATTGGTTTCTCTTCTTGTTCTTGTCTTTCGACATGATCTTGTGGAAGGTAG
GACAATGCATACAAATAGAGGCAGTGGGGATTATCACGATCATCCTTGCAATCCAAGCGATCCAAAGTGCGACAAACCTT
GTAATCCAGAGAATCCAAATTGCAGAATGAAACAAGGTGTCATTGAGCCAAATAGAGGCAATGGGTATCTGCACGATGAT
CCTCCTTGCAATCCAAATGATCCAAAGTGCGACAAACCTTGTGATCCAGAGAATCCAAATTGCTGA