Details for Lyrate rockcress Locus 16036509

Position : sca3 ( 5`- 8831411 .. 8833438 -3` )
Annotation : [B2G] DELTA-VPE [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16036509

Protein [Map View]
MSSLGHFQILVFLHALLIFSAESRKTHLVNDNDVESSDKSAKGTRWAVLVAGSNDYSNYRHQADICHAYQILRKGGLKDE
NIIVFMYDDIAFSSENPRPGVIINKPDGEDVYKGVPKDYTEETVNVENFYNVLLGNESGVTGGSGKVVKSGPNDNIFIYY
ADHGAPGLLAMPTGDEVLAKDFNKVLEKMHKRKSYNKMVIYVEACESGSMFEGILKKNLNIYAVTAANSKENSFGTYCPE
SYTPSAPEFETCLGDVFSISWLEDSDLHDMSKETLKQQYHVVKRRVGSDVEQTSHVCRFGTKEMLNDYLASYIGRNPENE
NFTFTESISSPISNSGLVNPRDIPLLYLQRKIQKAPVGSPESKEAQKKLFDEMNHRKQIDQSITEILRLSVKQTNVLNLL
TSTRTTGQPLVDDWDCFKTLVNSFKNHCGATVNYGLKYTGALANICNMGVDVKQTVSAIEQACSVK*

DNA
ATGTCTAGTCTTGGTCACTTTCAGATCCTTGTTTTTCTTCATGCTTTGCTTATATTCTCAGCTGAATCTCGCAAAACCCA
TTTGGTGAACGATAATGATGTTGAATCTAGCGACAAGAGTGCAAAAGGCACGCGATGGGCTGTTTTAGTTGCTGGATCAA
ATGATTATTCTAACTACAGGCATCAGGCTGATATATGCCATGCGTATCAGATACTCCGAAAAGGCGGTCTAAAAGATGAA
AACATCATTGTCTTTATGTATGATGATATCGCGTTTTCCTCGGAGAATCCTAGGCCTGGAGTTATCATCAATAAACCAGA
TGGAGAAGATGTTTATAAAGGAGTTCCTAAGGACTACACTGAAGAAACTGTTAATGTTGAAAACTTCTATAATGTGCTAC
TTGGAAATGAAAGTGGTGTCACAGGAGGAAGTGGCAAAGTTGTGAAAAGTGGTCCTAATGATAACATCTTCATCTACTAT
GCTGATCATGGAGCTCCTGGCTTACTAGCGATGCCCACTGGTGATGAGGTCCTTGCAAAAGATTTTAATAAAGTCTTGGA
GAAGATGCATAAGCGAAAAAGCTACAACAAGATGGTGATCTATGTTGAAGCATGTGAATCTGGAAGTATGTTTGAAGGGA
TTTTAAAGAAAAATCTCAATATATACGCAGTGACTGCTGCTAATTCGAAAGAGAACAGCTTTGGAACTTACTGCCCTGAG
TCGTATACTCCTTCTGCTCCTGAGTTTGAAACTTGTCTCGGCGATGTATTTAGCATCTCTTGGCTTGAGGACAGTGACCT
TCATGACATGAGCAAGGAGACTTTGAAGCAGCAATATCACGTTGTAAAGAGAAGAGTAGGATCTGATGTAGAACAGACTT
CTCATGTATGCCGTTTCGGGACCAAGGAGATGCTTAATGATTATCTTGCCTCTTACATTGGAAGAAATCCTGAAAACGAA
AACTTCACTTTCACTGAATCCATTTCCTCACCAATCTCTAATTCTGGCTTGGTCAATCCGCGCGATATCCCTCTGTTATA
TCTCCAGAGAAAGATTCAAAAAGCTCCAGTGGGATCACCTGAAAGCAAAGAAGCTCAGAAGAAATTGTTTGACGAAATGA
ATCATAGGAAACAAATCGATCAGAGCATTACAGAGATTCTGCGACTTTCGGTTAAACAAACCAATGTCTTAAATCTCCTA
ACTTCCACAAGAACAACAGGACAGCCTCTAGTAGACGATTGGGATTGTTTCAAGACTCTGGTTAATAGCTTCAAGAATCA
CTGCGGTGCAACAGTGAATTACGGATTGAAGTATACAGGAGCGCTTGCCAATATCTGCAATATGGGAGTGGATGTGAAGC
AAACTGTTTCAGCCATTGAACAAGCTTGTTCAGTTAAATGA