Details for Lyrate rockcress Locus 16036465

Position : sca3 ( 5`- 2793673 .. 2795946 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_340860 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16036465

Protein [Map View]
MESNKTFWIIVIFTVSILVTISTPVESKCAPPSESESPSPAPAPGQEVMKPITSPANSPAELDTYSPAASPEAPADSISP
TNAPAETDIDSPAASPEAPVASPEAPAESSSAAPSGINPPLLSPEIKTICGKTDNPPLCKSSVSPLLTPQLKPDTSSVLI
LAIQASINATKAAMATVEKAGASDCQELYDDAVVNLEDAVNAVKSRDIATVNTNLSAAMTDYSTCNDGFEEAGEPNPLAD
VADKLTKMVSNCLAISTLIKGSQLIPSVVYRERGSGNSPRVRQLKVCGPLSIEGGSVAKRIFFRRFKIGDLDLAEGNFQP
EIPQTS*

DNA
ATGGAGTCGAATAAAACCTTTTGGATCATCGTGATCTTCACGGTTTCTATTTTGGTCACGATCTCTACGCCTGTAGAATC
CAAATGTGCACCACCTTCCGAATCAGAGTCTCCATCTCCGGCACCTGCTCCGGGACAAGAAGTTATGAAACCGATCACTA
GTCCGGCAAATTCTCCGGCGGAGTTAGATACATACTCTCCCGCGGCGTCACCAGAAGCTCCCGCCGATTCAATTTCCCCA
ACGAATGCTCCGGCGGAGACAGATATCGACTCTCCCGCAGCGTCACCAGAGGCTCCTGTCGCGTCACCAGAAGCTCCCGC
CGAGTCTTCCTCTGCTGCACCATCTGGAATCAACCCGCCATTGTTATCTCCGGAGATCAAAACCATTTGCGGCAAAACCG
ATAACCCTCCGTTATGCAAATCTTCCGTTAGTCCTCTGTTAACGCCTCAACTGAAACCAGACACTTCCTCCGTCCTCATT
CTCGCGATTCAAGCTTCCATTAACGCGACCAAGGCGGCGATGGCCACCGTGGAAAAAGCAGGCGCCTCCGATTGTCAGGA
GTTGTACGATGACGCCGTTGTGAATTTGGAAGACGCGGTTAACGCCGTTAAGTCACGTGACATTGCCACCGTTAACACAA
ACTTGAGCGCAGCGATGACAGATTACAGCACGTGTAACGACGGTTTTGAAGAAGCGGGAGAGCCTAACCCGTTGGCTGAC
GTGGCCGATAAGCTTACGAAGATGGTTAGTAACTGTCTCGCCATCTCTACGTTGATCAAAGGGTCTCAACTGATTCCAAG
TGTGGTTTATCGAGAAAGAGGGTCTGGAAACAGTCCTCGTGTGCGCCAACTAAAAGTGTGCGGGCCTCTGTCAATTGAAG
GTGGATCAGTTGCCAAGAGGATCTTTTTTAGACGCTTCAAAATAGGAGATCTAGACCTAGCGGAAGGCAATTTCCAACCT
GAAATTCCACAAACATCATGA