Details for Lyrate rockcress Locus 16036456

Position : sca3 ( 5`- 8219976 .. 8222306 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16036456

Protein [Map View]
MAQMQREEVESVTTEKKGLDGGGGSSGAQATAFKFNAQAPEFVPRSHTTAPATQVSPVSGYFYPCFHYNGGCIGGCGGGV
CGGGGTGVGTQSSDWIYVGGGDPTAQHQHVHDPAAAFFISNPAVQFPANQNSSSSSKNLLSDDLRLKIVKQVEYQFTDMS
LLANESISKHISKDPEGYVPISYIASTKKIKALTSNHHLVSLALRSSSKLVVSEDGKKVKRTSPFTDRDREELQGRTVVA
ENLPDDHSYQNLEKIFGVVGNVKAIRICHPPESNSSRPKGDFLMSNKIHALIEYDNTVIADKAVEKLNDERNWRKGLRVR
LLLRCSPKSVLKNRRNFDGILIDDELPSYESGEDSPRLHLTESQLDNDGDDNNVGGLWGKGRGKGRGRSPRSYAVGGGGR
SFGIGLGVSLGIPSLGSHESSSPKTATKGPRMPDGTRGFTMGRGKPSISLSPNNL*

DNA
ATGGCACAGATGCAGCGAGAAGAAGTAGAGTCCGTCACGACGGAGAAGAAAGGATTAGACGGAGGTGGCGGATCTTCAGG
CGCTCAGGCGACGGCGTTCAAATTCAACGCTCAGGCGCCGGAATTTGTACCACGATCACATACCACCGCACCAGCAACGC
AGGTTTCTCCGGTATCCGGTTACTTTTATCCTTGTTTCCATTACAACGGCGGTTGCATAGGAGGATGCGGCGGAGGAGTC
TGCGGTGGTGGAGGGACCGGCGTTGGTACTCAATCGTCGGACTGGATCTACGTGGGAGGAGGAGATCCTACTGCTCAGCA
TCAACATGTTCATGATCCGGCTGCTGCGTTTTTCATTTCGAATCCGGCGGTTCAGTTTCCGGCTAACCAGAACTCGTCTT
CTTCGTCGAAGAATCTGCTTTCCGATGATCTCCGTCTTAAGATCGTCAAACAGGTTGAGTACCAATTTACTGACATGAGT
CTCCTAGCCAACGAGTCTATTTCAAAGCATATAAGCAAAGATCCTGAAGGTTATGTGCCCATATCCTATATTGCTTCGAC
CAAGAAGATCAAGGCTTTAACGAGTAACCACCACCTAGTTTCACTTGCTCTACGCTCCTCTTCAAAGCTTGTTGTGAGTG
AAGATGGTAAGAAAGTTAAGCGTACAAGTCCATTTACTGATAGAGACAGAGAGGAATTGCAGGGCAGGACTGTCGTTGCA
GAGAATTTGCCAGATGATCATTCTTACCAGAACCTTGAGAAGATCTTTGGAGTTGTTGGAAACGTCAAAGCGATTCGTAT
CTGTCATCCTCCAGAATCCAACTCCTCTCGTCCAAAAGGCGATTTCTTGATGAGCAACAAAATTCACGCCCTTATCGAGT
ATGACAACACTGTTATCGCGGATAAAGCAGTGGAGAAGCTGAACGATGAAAGAAACTGGAGGAAAGGGCTTCGTGTGAGG
CTGCTTCTTAGATGCTCACCCAAATCGGTGCTCAAGAACCGAAGAAACTTCGATGGAATTCTCATCGATGATGAACTTCC
TTCTTATGAATCTGGAGAAGACTCTCCGCGTCTCCATTTAACCGAATCACAGCTTGATAACGACGGTGATGACAACAATG
TTGGTGGACTGTGGGGTAAAGGGAGAGGAAAAGGACGAGGACGATCCCCAAGAAGCTACGCAGTAGGAGGAGGAGGACGT
AGCTTCGGGATTGGGCTCGGAGTCAGCCTCGGGATACCGAGCCTGGGCTCACACGAATCTTCGTCTCCTAAAACAGCAAC
AAAGGGACCAAGAATGCCTGATGGAACCAGAGGCTTCACCATGGGACGTGGCAAACCTTCCATCTCACTCTCACCTAACA
ATCTCTAA