Details for Lyrate rockcress Locus 16036448

Position : sca3 ( 5`- 7748574 .. 7743813 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036448

Protein [Map View]
MAVSAGALAFPALSVRATLNPENKDEQGNISTSSTQKFTYSRASPAVRWPHLSLRETYDSRASTPSQPLSSPVSPTDTPD
SAEFVDSIGSSEHQKTKDETAVASRRRRVKKMNKVALIKAKDWRERVKFLTDKILSLKPNQFVADILDARPVQMTPTDYC
FVVKSVGQESWQRALEVFEWLNLRHWHSPNARMVAAILGVLGRWNQESLAVEIFTRAEPTVGDRVQVYNAMMGVYSRSGK
FSKAQELLDAMRQRGCVPDLISFNTLINARLKSGGLTPNLVVELLDMVRNSGLRPDAITYNTLLSACSRDSNLEGAVKVF
EDMEAHRCQPDLWTYNAMISVYGRCGLAAEAERLFIELELKGFSPDAVTYNSLLYAFARERNTEKVKEVYQQMQKMGFGK
DEMTYNTIIHMYGKQGQLDLALQLYKDMKGLSGRNPDAITYTVLIDSLGKANRSVEAAALMSEMLDVGIKPTLQTYSALI
CGYAKAGKREEAEDTFSCMLRSGTKPDNLAYSVMLDVLLRGNETRKAWVLYRDMISDGHTPSHSLYELMILGLMKENRSD
DVQKTIRDMEELCGMNPLEISSVLVKGECFDLAARQLKVAITNGYELENDTLLSILGSYSSSGRHSEAFELLEFLKEHAS
GSKRLINEALIVLHCKVNNIGAALDEYLADPCVHGWCFGGSTMYETLLHCCVANEHYAEASQVFSELRLSGCEPSESVCK
SMVVVYCKLGFPETAYQVVNQAETKGFHFACSPMYTDIIEAYGKLKLWQKAESVVGNLRQSGRTPDLKTWNSLMSAYAEC
GCYERARAIFNTMMRDGPSPTVESINKLLHALCVDGRLEELYVVVEELQDMGFKISKSSILLMLDAFARAGNIFEVNKIY
SSMKAAGYLPTIRLYRMMIELLCKGKRVRDAEIMVSEMEEANFKVELAIWNSMLKMYTVIEDYKKTVQVYQRIKESGLEP
DETTYNTLIIMYCRDRRPEEGYSLMQQMRNLGLDPKLDTYKSLISAFGKQKCLEQAEQLFEELLSKGLKLDRSFYHTMMK
ISRDSGSDSKAEKLLQMMKNAGIEPTLATMHLLMVSYSSSGNPQEAEKVLSNLKNTEVELTTLPYSSVIDAYLRSKDYKS
GIERLLEMKKEGLEPDHRIWTCFVRAASFSKEKSEVMLLLKALQDIGFDIPIRLLGGRPELLVSEVDGCFEKLKSIEDNA
ALNFANALLNLLWAFELRATSSWVFQLAIKRGIFSLDVFRVADKDWGADFRRLSGGAALDASLEGYPESPKSVVLITGTA
EYNGVSLDKTLKACLWEMGSPFLPCKTRTGLLVAKAHSLRMWLKDSPFCFDLELKDSVSLPESNSMDLIDGCFIRRGLVP
AFNHIKERLGGFVSPKKFSRLALLPDEMRERVIKTDIEGHRQKLEKMKNKNKRNETNGVNTRRKFVRSK*

DNA
ATGGCGGTTTCTGCAGGGGCTCTAGCTTTTCCTGCTTTATCCGTTCGCGCCACTCTTAATCCTGAGAATAAAGATGAACA
AGGGAACATCAGCACTAGCTCTACCCAGAAATTCACTTATAGTCGAGCTTCTCCCGCCGTCCGATGGCCACATTTGAGTC
TCCGTGAGACTTATGATTCCAGAGCTTCAACACCGTCACAACCTCTTTCTTCTCCGGTTTCTCCCACCGATACACCGGAT
TCAGCTGAATTCGTCGATTCAATTGGCTCCAGCGAGCATCAAAAGACGAAAGATGAAACCGCCGTGGCGAGTCGGAGAAG
GAGAGTGAAGAAGATGAATAAAGTGGCTTTGATTAAGGCCAAGGATTGGAGAGAGCGAGTCAAATTTCTGACGGATAAGA
TTCTAAGCTTGAAACCTAATCAGTTCGTTGCGGATATTCTCGATGCTCGTCCTGTTCAGATGACTCCTACTGATTACTGC
TTCGTCGTGAAATCGGTTGGTCAAGAGAGTTGGCAACGAGCTCTTGAGGTTTTTGAGTGGCTCAATCTCCGTCATTGGCA
TTCACCTAATGCTCGGATGGTGGCTGCTATACTCGGTGTTTTGGGACGGTGGAATCAGGAATCGCTTGCGGTTGAGATTT
TCACTAGGGCTGAGCCAACCGTCGGAGATAGGGTTCAGGTGTACAACGCTATGATGGGGGTTTATTCACGTAGTGGCAAG
TTTTCAAAAGCACAAGAGCTGCTCGATGCAATGCGTCAGAGAGGGTGTGTTCCAGACCTTATTAGTTTCAATACTCTCAT
CAATGCTAGGCTTAAGTCTGGTGGGTTGACTCCGAATTTGGTTGTTGAATTATTAGATATGGTGAGGAATTCGGGTCTTA
GGCCTGATGCTATCACTTACAATACTCTTCTTAGTGCCTGTTCGCGGGATTCGAACTTGGAGGGTGCAGTGAAGGTGTTT
GAGGATATGGAAGCTCATCGGTGTCAGCCTGACTTGTGGACTTATAATGCTATGATTTCTGTTTATGGAAGATGTGGGCT
TGCTGCTGAAGCTGAGAGGCTCTTCATAGAGTTGGAGCTTAAAGGTTTTTCCCCTGATGCAGTGACATACAACTCTTTGC
TCTATGCTTTTGCCAGAGAAAGAAATACGGAGAAGGTGAAGGAGGTGTACCAACAGATGCAGAAAATGGGGTTTGGGAAA
GACGAGATGACTTACAACACGATCATTCACATGTATGGCAAGCAGGGGCAACTTGATCTTGCACTACAGCTTTATAAGGA
CATGAAAGGTTTGTCGGGTAGGAACCCTGATGCTATTACTTACACTGTTTTGATCGATTCTCTTGGAAAAGCAAACCGAA
GTGTGGAAGCCGCAGCTCTAATGTCTGAGATGCTTGATGTTGGGATCAAACCAACTCTGCAGACCTACAGCGCTCTCATC
TGCGGTTATGCCAAGGCTGGGAAGCGAGAGGAGGCTGAGGATACTTTCAGTTGCATGTTGCGCTCAGGCACTAAACCTGA
TAATTTAGCGTATTCTGTAATGTTGGATGTATTACTAAGAGGCAACGAGACAAGAAAGGCGTGGGTTTTATATCGTGATA
TGATTTCTGATGGCCATACACCGTCTCACAGTCTGTATGAGTTGATGATACTTGGACTTATGAAGGAAAACAGGTCAGAT
GACGTTCAGAAAACCATCAGAGACATGGAAGAATTGTGTGGCATGAACCCACTAGAGATTTCATCAGTGCTTGTTAAGGG
GGAATGCTTTGATCTTGCTGCTAGACAGTTGAAAGTGGCTATCACCAATGGTTATGAATTGGAAAACGACACTCTATTGT
CTATCCTGGGTTCCTATAGTTCATCAGGCAGACATTCAGAAGCGTTTGAGTTACTTGAATTTTTGAAAGAACACGCCAGT
GGATCTAAAAGACTTATAAACGAAGCACTAATTGTTCTACATTGCAAGGTTAACAATATAGGCGCTGCTCTAGATGAATA
TCTCGCTGACCCATGTGTTCATGGCTGGTGTTTTGGCGGTTCAACCATGTATGAGACTCTATTACACTGCTGTGTAGCAA
ATGAACATTATGCTGAAGCTTCTCAAGTTTTCTCTGAACTGAGACTATCTGGCTGCGAACCTTCAGAAAGTGTTTGTAAA
AGCATGGTTGTGGTGTATTGCAAGCTTGGCTTTCCAGAGACAGCTTATCAAGTGGTTAATCAAGCTGAGACAAAAGGCTT
CCACTTTGCTTGTTCACCTATGTATACTGATATCATTGAGGCTTATGGAAAACTAAAGCTATGGCAGAAAGCGGAGAGTG
TGGTTGGCAACCTAAGACAAAGTGGACGAACACCTGATCTGAAGACATGGAACAGCTTGATGTCAGCTTATGCTGAGTGT
GGCTGTTACGAGCGGGCAAGGGCTATTTTTAACACAATGATGAGGGATGGTCCGTCTCCTACTGTTGAATCCATCAATAA
GTTACTGCATGCTTTGTGTGTTGATGGGAGACTTGAAGAGCTCTACGTTGTTGTTGAAGAATTGCAAGATATGGGCTTCA
AGATTAGCAAAAGCTCCATTCTTTTGATGCTTGACGCATTTGCCCGGGCTGGAAATATCTTTGAGGTAAATAAGATATAC
AGTAGCATGAAAGCTGCTGGTTACTTACCCACGATTCGCCTTTATAGGATGATGATTGAGCTTCTCTGCAAAGGTAAACG
AGTTAGAGATGCTGAAATTATGGTCTCTGAAATGGAAGAGGCCAATTTCAAGGTTGAGCTTGCTATATGGAATTCAATGC
TGAAGATGTATACGGTTATCGAGGATTACAAGAAGACAGTTCAAGTATACCAGAGGATAAAAGAAAGTGGACTGGAACCA
GATGAGACCACTTACAATACGCTGATTATAATGTATTGTAGAGACAGACGACCAGAAGAAGGGTACTCACTTATGCAGCA
AATGAGAAATCTTGGTTTGGACCCAAAATTGGACACATACAAGAGCTTGATCTCTGCTTTTGGTAAGCAAAAATGCCTTG
AACAAGCTGAACAACTGTTTGAAGAGCTTCTCTCAAAAGGTTTGAAACTAGACCGTTCATTTTACCACACGATGATGAAA
ATATCCCGAGATTCTGGAAGCGACTCTAAGGCAGAGAAGTTATTGCAAATGATGAAGAATGCGGGAATAGAACCAACACT
TGCTACAATGCATCTGCTTATGGTTTCATATAGTTCTTCAGGAAATCCCCAAGAAGCTGAAAAAGTTCTTAGTAACCTGA
AAAACACAGAAGTGGAACTAACAACTCTGCCTTATAGTTCAGTTATTGATGCTTACCTTAGGAGCAAAGATTATAAAAGT
GGAATAGAAAGACTTTTGGAAATGAAGAAAGAGGGCCTAGAGCCAGACCACAGGATATGGACTTGCTTTGTTAGGGCGGC
GAGTTTTTCCAAGGAAAAAAGCGAAGTCATGTTGCTGCTTAAAGCTCTTCAAGATATTGGTTTTGATATTCCTATCAGGC
TTTTAGGTGGAAGACCTGAGTTGCTAGTTTCTGAGGTGGATGGATGTTTCGAGAAACTGAAATCCATAGAGGACAATGCT
GCTCTCAATTTTGCGAATGCTCTTTTGAATCTTCTCTGGGCGTTTGAACTCAGAGCTACTTCATCATGGGTTTTCCAATT
GGCAATCAAAAGGGGTATCTTCAGTCTCGATGTTTTTAGGGTGGCGGACAAGGACTGGGGTGCGGATTTCAGAAGATTGT
CGGGAGGTGCAGCACTTGATGCATCACTCGAAGGCTACCCAGAGTCTCCGAAGTCAGTAGTCTTAATCACAGGGACCGCA
GAGTACAACGGTGTATCCCTTGATAAAACGCTAAAGGCGTGTCTTTGGGAAATGGGTTCTCCATTTCTCCCCTGCAAGAC
GAGAACGGGACTGCTAGTGGCCAAAGCTCACTCTCTCAGAATGTGGTTGAAGGACTCGCCGTTCTGCTTCGACTTGGAGC
TAAAAGACTCAGTGTCTTTACCAGAATCAAACTCGATGGACCTGATTGACGGGTGTTTCATAAGACGTGGACTTGTTCCT
GCGTTTAACCACATCAAAGAGAGACTTGGTGGGTTTGTGTCACCAAAGAAGTTTTCGAGACTGGCATTGCTACCAGACGA
GATGAGAGAACGAGTGATAAAGACAGATATAGAAGGACATAGACAGAAGTTGGAGAAAATGAAGAATAAGAACAAAAGAA
ACGAAACAAATGGTGTTAACACTCGAAGGAAGTTCGTCAGAAGTAAGTGA