Details for Lyrate rockcress Locus 16036443

Position : sca3 ( 5`- 7901886 .. 7900924 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036443

Protein [Map View]
MFSSLSVSSSLSSSLVTSFVAVKAVPVTGPLIPRRDLLSIRIRASSNQNGSGYCFPEKLKYFAKSAILIGAAVSMTGKFS
TLPVKAESPVTTTEEAYQEVKEEKLSEIAPLSELLDSTPEAVETLRSLLQQKLEKGEDEEALKLLERLVTAQPDETEWKF
LMARLLGEMGRPENARQMFEEILQRNPLSFEALFENALLMDRSGEGAAVLQRLEDALAVAEAEYLVKEARDVRLIIAQIH
FLQKNVDEALKSYEQLTKEDPKDFRPYFCRGMIYSLLDKNVEAKEQFAKYRELSPKKFEVEGYLRTPLSKMKLFGGNEEN
*

DNA
ATGTTTTCGTCTCTCTCAGTTTCTTCTTCACTTTCTTCTTCATTGGTTACTTCTTTCGTCGCCGTCAAAGCGGTTCCGGT
CACCGGACCTCTGATTCCCCGTCGCGATCTTCTTTCTATTCGTATCAGGGCTAGCTCGAATCAGAATGGTTCCGGTTATT
GTTTTCCAGAGAAGCTGAAATATTTTGCCAAATCAGCGATTCTCATCGGCGCTGCTGTTTCAATGACCGGAAAGTTCTCA
ACTTTACCGGTGAAAGCAGAATCTCCGGTTACGACTACCGAAGAAGCCTACCAGGAAGTGAAAGAAGAGAAACTGTCTGA
GATCGCGCCATTATCTGAGCTTTTGGATTCCACTCCTGAGGCTGTTGAGACACTGAGATCACTCCTGCAGCAGAAGCTAG
AGAAGGGAGAAGATGAAGAAGCTCTTAAGCTCTTAGAGAGACTAGTAACTGCACAACCAGATGAAACAGAGTGGAAGTTC
TTAATGGCCAGGCTGTTGGGCGAAATGGGTCGTCCCGAAAACGCACGCCAGATGTTCGAGGAAATTCTCCAACGAAACCC
ACTTTCGTTTGAGGCTTTATTCGAGAATGCATTGCTCATGGACAGGTCCGGGGAAGGAGCTGCAGTGCTGCAGAGGCTGG
AAGATGCTTTAGCTGTAGCCGAGGCTGAGTATTTGGTGAAGGAAGCGAGAGACGTGAGACTGATCATTGCTCAGATACAT
TTCTTGCAGAAGAATGTGGATGAAGCATTGAAGAGCTACGAGCAGCTGACGAAAGAGGATCCAAAGGATTTCAGACCGTA
TTTCTGTCGAGGTATGATCTATAGCTTGCTTGACAAGAACGTTGAAGCTAAGGAACAGTTTGCGAAGTACAGAGAGCTTT
CTCCGAAGAAATTTGAAGTAGAAGGGTACTTGAGGACTCCATTGTCTAAAATGAAGCTTTTTGGTGGTAATGAAGAGAAC
TAA