Details for Lyrate rockcress Locus 16036422

Position : sca3 ( 5`- 7576295 .. 7571337 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479255 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16036422

Protein [Map View]
MSNTSEDGDGASVTTGGLFPVFPTSANSVSAFSGAPQWLRNASFTTDLSVINAAASTAPSLSEVEAGDEEDEKGDADGNI
GEANQPRVYNLVEEEESLESDGDKVMRKRGKKKKRKSGNSSDESRSRKSSVKASDEYYSKPVKDYYLDTRPDPDNLAYGS
IYRMNVPRYKLDNSQRVPGSGSLRYYLRNRRSSMLDTEIDIDSLEGRAKSDTRYWYAKHAALERNKNFKRIRLSASTEAV
DSSFDNFIPLEEDETVQESDEEDVLSKDSKMGASWEDEVLNKTREFNKVTRERPHDEKAWLAFADFQDKVSSMQSQKGVR
LQTLEKKISILEKAFELNPDSEELLLALLKAYRRRDNADVLISRWEKALMQNSASYKLWREFLCVVQGEFSRFKVSEVRK
LYSYAIQALSSACSKRHRQVDTTSEPLDSAAIQQELVLVDMLVSLCRFEWQAGYQELATALLQAEVEFSIFSPSLLLTEQ
SKLRLFEHFWSSNGARVGEEGAFGWLLWLEKEEENRQKILKEEFSDDNEVGGWTGWTEQVSGRNGDIASANTGEVDVDRE
SLDEEMEDENSKPEDDTEAMLKLLGIDVNAAASDEVKDTSTWVKWFEEEVSRDHSQWMPTRKAGKFSSVDGIGEGEDEEQ
LSSVVLYEDINGYLFSLCSNEARLSLVYQFIDFFGAHISPWTSSNSLSWSEKISSLETLSDSMLENLRSVHECLSKSDSA
NCFSLVSLLGGSYDISMRAEMMKFLRNAILLCLNVFPRNYILEEAVLVAEELYVTNMKTCEVATTPCQALAKRLLKSDRQ
DLLLCGVYAQREAASGNMKHARRVFDMALTSICGLPQELQCNAPLLCLWYAESEVANSNGSGRDTESSSRAIHILCYLGS
GLAYIPYTSQSSSMQILRARQGFREKLKKIQSTWSHGVTDDQSAALVCSAALFEELTNDLPGAVEILEHMFSSVLPGRKS
QSRQLELLFNYYVRMLQRHQDDLTLSQLWKPISEGLQLYPLNPMLYRALVDICNHRMTSHRLRMMFDDYSRKNSSVVVWL
FALCYELSKGGSLHRIRGLFERALAQDTQNNSVILWRCYIAYEIDIAHNPSAARRIYFRAINACPWSKKLWLDGYGKLSS
VLTAKELSDLQEVMRDKELNIRTDIYEILLMQG*

DNA
ATGTCGAATACATCAGAGGACGGCGACGGAGCATCGGTAACTACAGGCGGCTTGTTCCCCGTCTTCCCTACTTCGGCGAA
CTCCGTCTCAGCTTTTTCTGGTGCTCCTCAATGGCTTCGCAACGCCAGCTTCACGACGGATCTCTCCGTCATCAACGCTG
CCGCTTCGACGGCTCCTTCCTTATCCGAGGTCGAGGCTGGAGACGAAGAAGATGAAAAAGGAGATGCCGATGGGAATATT
GGTGAAGCTAATCAGCCTAGAGTATACAATTTGGTTGAAGAAGAAGAGTCTTTGGAGTCTGATGGCGACAAGGTAATGAG
GAAGCGGGGGAAAAAGAAGAAGCGGAAGAGTGGTAATTCTTCGGATGAATCTCGTTCAAGGAAATCCTCAGTTAAGGCAT
CTGATGAATACTATTCGAAACCTGTGAAGGATTATTATTTGGATACTCGTCCTGATCCAGATAATCTGGCTTATGGCTCT
ATTTACAGGATGAATGTTCCTCGTTATAAACTTGACAATTCTCAGAGAGTTCCTGGTTCAGGTTCTCTGAGGTATTATTT
GCGGAATCGGCGTAGTTCTATGCTTGACACAGAGATTGATATTGATTCTTTGGAGGGGAGAGCAAAGTCTGATACCCGAT
ATTGGTATGCAAAACATGCTGCCTTGGAACGCAACAAGAATTTCAAGCGTATTCGTTTATCTGCTTCAACTGAAGCTGTG
GATTCGTCCTTTGATAATTTCATTCCACTGGAGGAAGATGAGACTGTCCAAGAAAGTGACGAAGAAGATGTTTTATCAAA
GGACTCAAAGATGGGAGCATCATGGGAGGATGAAGTGCTGAATAAAACGCGAGAGTTCAACAAAGTGACGAGGGAGCGTC
CACATGATGAAAAGGCATGGCTGGCATTTGCTGATTTTCAAGACAAGGTTTCAAGTATGCAATCTCAGAAAGGAGTTCGC
CTGCAGACTTTAGAGAAAAAGATTAGTATACTTGAGAAGGCTTTTGAACTGAACCCAGATAGCGAAGAACTGTTGCTTGC
TCTGCTCAAGGCATACCGACGCAGAGACAACGCGGATGTACTAATCAGTAGGTGGGAAAAGGCACTTATGCAAAATTCCG
CAAGCTACAAGTTATGGAGAGAGTTTCTATGTGTTGTTCAAGGGGAGTTCTCCAGATTCAAAGTATCAGAAGTGAGGAAG
CTGTATTCTTATGCGATCCAGGCTCTTTCTTCTGCTTGCAGCAAGCGACATAGGCAGGTGGATACAACATCTGAACCGTT
GGATTCTGCTGCCATCCAGCAGGAACTCGTTCTAGTCGATATGCTTGTTAGCCTCTGCAGGTTTGAGTGGCAGGCTGGTT
ACCAGGAGCTCGCCACAGCGTTACTTCAAGCTGAAGTGGAATTTAGCATCTTTTCTCCATCTTTGTTGCTAACTGAACAG
AGTAAATTAAGACTGTTTGAGCACTTTTGGAGCAGTAATGGTGCTAGAGTTGGAGAAGAAGGAGCTTTTGGATGGTTATT
GTGGCTGGAGAAAGAGGAGGAAAACAGGCAGAAAATTTTGAAAGAAGAATTCTCTGATGACAATGAGGTAGGTGGTTGGA
CAGGTTGGACAGAACAGGTCTCAGGTAGAAATGGAGATATTGCTTCAGCTAACACTGGAGAGGTCGATGTTGATCGTGAG
AGTCTGGATGAGGAAATGGAAGACGAGAATAGCAAACCGGAAGATGACACTGAAGCTATGCTGAAATTATTGGGCATTGA
TGTCAATGCTGCGGCCAGTGATGAGGTTAAAGATACATCAACTTGGGTAAAATGGTTTGAAGAAGAGGTTTCTCGAGATC
ACAGTCAATGGATGCCTACTCGGAAAGCTGGTAAATTCTCCAGTGTTGATGGAATAGGTGAGGGAGAAGATGAAGAGCAA
CTCTCAAGTGTTGTACTATATGAAGATATAAATGGATATCTATTTTCTTTATGTTCAAACGAGGCCCGCTTATCTCTGGT
ATACCAGTTCATTGATTTCTTCGGTGCACATATCTCCCCATGGACTTCCAGCAACAGTTTGTCGTGGAGTGAGAAAATAA
GTAGCCTTGAAACATTGTCAGATTCTATGCTAGAAAACTTGAGAAGTGTTCATGAATGTCTGTCGAAATCAGATAGTGCC
AACTGCTTCAGCTTGGTATCTCTTTTAGGTGGCAGCTATGACATATCTATGCGGGCTGAGATGATGAAGTTTCTCCGCAA
TGCCATCTTGCTTTGTCTAAATGTTTTTCCGCGAAACTACATTCTGGAAGAAGCTGTGCTTGTTGCAGAAGAGTTATATG
TAACAAATATGAAAACATGTGAGGTAGCAACTACGCCATGCCAAGCTTTGGCCAAACGTCTCCTGAAAAGTGACCGGCAG
GATCTACTACTTTGTGGAGTTTATGCACAGCGAGAAGCTGCTTCTGGAAATATGAAACATGCAAGACGAGTTTTCGACAT
GGCACTGACTTCTATCTGTGGCCTCCCTCAGGAATTACAGTGTAACGCTCCTTTGCTATGTTTATGGTATGCTGAATCGG
AAGTAGCCAATAGTAACGGCAGTGGTAGGGATACAGAATCATCATCTCGTGCCATACATATTCTGTGCTACCTGGGAAGT
GGTCTAGCTTATATTCCTTATACTTCCCAGTCTTCAAGTATGCAAATCCTTAGAGCACGCCAAGGGTTCAGAGAGAAGCT
TAAGAAGATACAATCAACCTGGTCTCATGGTGTCACAGATGATCAATCAGCAGCGCTTGTTTGTTCGGCAGCTCTATTTG
AGGAGTTAACAAATGACCTTCCTGGTGCTGTTGAAATCCTAGAGCACATGTTCAGTTCTGTTCTTCCAGGAAGAAAAAGT
CAAAGTCGTCAGCTTGAACTCTTGTTCAATTATTATGTGAGAATGCTTCAGAGACACCAGGACGATTTAACTTTGTCACA
ACTTTGGAAGCCCATATCAGAGGGACTGCAACTGTATCCTCTCAATCCCATGCTTTATCGAGCTTTGGTGGACATCTGTA
ACCACCGTATGACATCCCATAGACTGAGAATGATGTTTGATGACTACTCCCGCAAGAATTCATCTGTCGTTGTTTGGCTG
TTTGCACTTTGTTATGAGTTGAGTAAAGGAGGCTCCCTACACAGAATCCGTGGATTGTTTGAAAGGGCATTGGCCCAAGA
TACACAAAACAACTCGGTTATTCTATGGCGTTGCTACATTGCATATGAGATCGACATCGCGCACAATCCATCAGCAGCTA
GAAGGATTTACTTCCGAGCTATAAATGCATGCCCATGGTCGAAAAAACTATGGCTGGATGGGTATGGGAAGCTGAGCTCA
GTCCTGACGGCAAAGGAGTTGTCAGATTTACAAGAAGTGATGCGGGACAAGGAACTGAACATTAGGACAGATATCTACGA
GATTCTTCTTATGCAGGGATGA