Details for Lyrate rockcress Locus 16036408

Position : sca3 ( 5`- 7539617 .. 7542783 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036408

Protein [Map View]
MASSTENDEFPILPIPKATPRAHTRAFTSRNRSVSLSNPTFSFDGFDSSSVVLGYTGPLRTQRIRPPLVQMSGPLHSTRR
TEPLFSPSPQEPPDSSSSSTVNVPPEDDFVFQNANLLRSGQLGMCNDPYCTTCPSYYNRQAAQFHTSRVSTSRFRTVLYD
DARGWAKRFASSVRRCLPGIMNPHSKFVQVWTRVLAFSSLVAIFIDPLFLFLLFIQQDNKCLAIDWRATKVLVSLRSITD
LVFYINILLQFRLAYVAPESRIVGAGQLVDHPRKIARHYFQGKFFLDLFIVLPIPQIMILWIIPAHLGTRREEYEKQIIR
ATVLFQYIPKLYRLLPLLAGQTPTGFIFESAWANFVINLLTFMLAGHAVGSCWYLSGLQRVKKCMLNAWNISVDERRNLI
DCSRGSYASESQRALWRDGASVNACFQESGFTYGIYLKAVNLTNQSSFFTRYSYSLFWGFQQISTLAGNLSPSYSVGEVF
FTMGIIGLGLLLFARLIGNMQNFLQSLDRRRMEMMLRRRDVEQWMSHRLLPEDIRKRVREAERYNWAATRGVNEEFLFEN
MPDDLQRDIRRHLFKFLKKVRIFSLMDESVLDSIRERLKQRTYIRSSTVLHRRGLVEKMVFIVRGEMESIGEDGSVLPLS
EGDVCGEELLTWCLERSSINPDGTKIKMPTKGLVSNRNVRCVTNVEAFSLSVADLEDVTSLFSRFLRSHRVQGAIRYESP
YWRLQAAMQIQVAWRYRKRRLQRFYTAQSSSNN*

DNA
ATGGCTTCCTCGACCGAGAACGACGAGTTTCCCATTCTTCCAATTCCAAAAGCAACACCTCGTGCTCACACTAGGGCTTT
TACTTCCAGGAACCGTAGTGTTTCTCTCTCAAACCCAACTTTCTCCTTTGACGGATTTGACAGCTCGAGTGTGGTTTTAG
GTTACACAGGTCCTCTTCGAACCCAGCGAATAAGACCTCCTTTAGTGCAAATGAGTGGTCCTCTTCACTCTACTCGCAGA
ACAGAACCTCTCTTCTCTCCTTCTCCTCAAGAACCTCCTGATTCCTCCTCCTCCTCTACCGTTAATGTTCCACCTGAAGA
TGATTTTGTCTTCCAAAACGCAAATCTCTTGAGATCTGGACAGTTAGGGATGTGCAATGATCCTTACTGCACTACTTGCC
CTTCTTACTACAACCGCCAAGCTGCTCAATTTCACACTTCCAGAGTTTCTACCTCTAGGTTTCGCACTGTTCTGTATGAT
GATGCTAGAGGTTGGGCTAAGCGATTTGCCTCCTCTGTTCGTAGATGCTTACCTGGAATAATGAATCCTCATTCCAAATT
CGTTCAAGTCTGGACTAGAGTCTTAGCCTTTTCAAGCTTAGTGGCCATTTTTATAGATCCTCTCTTCTTGTTCCTCTTAT
TTATCCAACAAGACAACAAATGCTTAGCGATTGATTGGCGTGCGACTAAAGTATTGGTGTCTCTTAGAAGTATAACGGAT
CTTGTATTCTACATTAACATTCTACTTCAGTTTAGGTTGGCCTATGTAGCCCCTGAATCTAGAATAGTTGGTGCCGGCCA
GTTAGTTGATCATCCAAGAAAAATTGCTCGCCATTACTTCCAAGGAAAGTTTTTTCTTGATCTGTTCATAGTGTTACCCA
TTCCACAGATAATGATATTATGGATAATACCAGCACACTTGGGCACACGCAGGGAAGAATATGAGAAACAGATTATACGC
GCTACGGTTCTTTTTCAATACATTCCAAAGTTATATAGACTCTTACCTCTTCTTGCTGGACAAACACCGACCGGCTTCAT
ATTTGAGTCAGCCTGGGCTAATTTTGTTATTAATCTTCTCACCTTCATGCTTGCTGGTCACGCTGTTGGCTCTTGCTGGT
ATCTTTCTGGTCTGCAGAGAGTTAAGAAATGCATGCTGAATGCTTGGAATATTTCTGTGGATGAACGTAGAAATCTTATC
GATTGTTCGCGTGGAAGTTATGCATCGGAGTCACAAAGAGCTCTCTGGAGAGATGGTGCTAGTGTCAATGCTTGTTTTCA
AGAGAGTGGTTTTACTTATGGGATCTATCTGAAGGCAGTGAATCTTACCAATCAATCTAGTTTCTTCACAAGATACAGTT
ATTCTCTGTTTTGGGGATTCCAACAAATAAGCACACTTGCTGGAAACTTATCCCCAAGTTACTCAGTGGGGGAGGTTTTC
TTTACAATGGGTATCATTGGACTAGGGCTTTTGCTTTTTGCGCGGCTTATCGGTAATATGCAGAACTTCCTTCAATCTCT
TGATCGGAGGAGGATGGAAATGATGCTGAGACGGCGTGATGTAGAGCAGTGGATGAGCCACAGACTGTTGCCAGAAGATA
TAAGAAAAAGAGTGCGGGAGGCTGAGCGGTACAATTGGGCTGCGACTAGAGGAGTTAACGAAGAATTTCTATTCGAGAAC
ATGCCTGATGACCTTCAAAGAGATATAAGACGACACCTCTTTAAATTTCTCAAGAAGGTGAGAATATTTTCGTTGATGGA
TGAATCAGTTTTAGATTCAATCCGTGAGAGGCTGAAACAGAGGACATACATAAGGAGTAGCACGGTGTTGCACCGCAGAG
GTCTAGTAGAAAAAATGGTATTCATAGTGAGAGGTGAGATGGAGAGCATTGGAGAAGACGGTTCTGTTCTTCCTTTATCA
GAAGGCGACGTTTGTGGTGAAGAACTTCTCACTTGGTGCCTCGAACGCTCTTCTATAAACCCCGATGGGACTAAGATAAA
GATGCCAACAAAGGGATTAGTTAGCAACAGAAATGTTAGGTGTGTGACAAACGTGGAAGCGTTTTCGCTGAGTGTAGCAG
ATCTTGAAGATGTAACAAGCTTGTTTTCAAGATTCTTAAGGAGTCATCGAGTGCAAGGAGCTATAAGGTACGAGTCTCCT
TATTGGAGACTACAAGCAGCGATGCAGATTCAAGTGGCTTGGAGATACCGAAAGAGACGACTTCAGAGATTTTACACTGC
TCAGTCTAGTTCCAACAATTAG