Details for Lyrate rockcress Locus 16036381

Position : sca3 ( 5`- 9570341 .. 9569124 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036381

Protein [Map View]
MSSPTQQNQSPQKVNEEVLLENPNDRVHLVDKPEPLELALSFLGGDGEIMENPEFLGDFMWEKSSSASGMNNNEIDWKEY
APKAEEYKSVVAKAIAEGTGHIIKGIFTCSNSYSKKIRKGGTIAEEVEERSGDISEIGGGDNNETKKENKHNKNLQRAEK
LWKVSEAIGMAVIEGEDMVSGWMVAPVVKSRLGKALLSTAPGELILASLDSFHNIIGAAEAAEIQTHSATSMAVTRLVSK
R*

DNA
ATGTCCTCACCAACCCAACAAAACCAATCTCCCCAAAAGGTGAACGAGGAAGTCTTGTTGGAGAATCCCAATGACAGAGT
CCATCTCGTCGATAAACCCGAACCGTTGGAGCTAGCCTTGAGTTTCTTAGGGGGAGACGGAGAAATCATGGAAAACCCTG
AGTTTCTAGGAGATTTCATGTGGGAGAAATCTTCAAGTGCTTCAGGTATGAACAACAATGAAATTGATTGGAAAGAGTAT
GCACCGAAGGCTGAAGAATACAAAAGCGTTGTAGCCAAGGCCATCGCCGAAGGAACAGGGCATATCATCAAGGGAATCTT
CACTTGTAGCAATTCTTACTCTAAGAAGATTCGCAAGGGAGGAACGATTGCTGAAGAGGTTGAGGAAAGAAGTGGTGACA
TATCAGAAATTGGTGGAGGTGACAACAATGAAACTAAGAAGGAGAATAAACACAACAAAAATCTTCAAAGAGCGGAGAAG
TTGTGGAAGGTGAGCGAGGCTATAGGAATGGCGGTCATAGAAGGTGAAGATATGGTGAGCGGTTGGATGGTAGCTCCGGT
GGTTAAATCGAGGTTAGGAAAGGCATTGTTATCCACTGCTCCAGGAGAGCTTATCTTGGCATCACTTGATTCTTTTCATA
ATATAATTGGTGCTGCTGAAGCGGCAGAGATACAAACTCATTCTGCCACATCCATGGCTGTTACTCGACTTGTGAGTAAG
AGGTAA