Details for Lyrate rockcress Locus 16036263

Position : sca1 ( 5`- 29165315 .. 29166382 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036263

Protein [Map View]
MSGRNRIHRDSYHDRRELPPERPFLRGPPLLQPPPPSLLEDLQIQDAEIRRLLNDNHRLADDRMVLERELVAAKEELHRM
NLMISDLRAEQDLQSMEFSEKRHKLEGDVRAMESYKKEASQLRGEVQKLNEIKRELSGNVQMLRKDLAKLQSDNKQIPGM
RAEVKDLQKELMHARDAIDYEKKEKFELMEQRQTMEKNMVSMAREVEKLRAELATVDSRPWGFGGSYGMNFNNMDGTFRG
SYGENDSYLGSSERSQYYSHGSGSQKKPRLDRH*

DNA
ATGTCTGGAAGAAACCGGATTCACCGAGACAGTTATCATGATCGGCGTGAATTACCTCCGGAGAGACCTTTTCTCCGAGG
CCCTCCATTGTTACAACCTCCACCACCATCTTTGTTAGAAGATCTTCAGATTCAGGATGCTGAAATTAGAAGGCTTTTGA
ATGATAATCATAGACTAGCTGACGACCGAATGGTTCTGGAGCGAGAACTCGTTGCTGCTAAAGAAGAGCTTCACCGTATG
AATCTGATGATTTCTGATCTTCGTGCTGAGCAAGATCTGCAGTCCATGGAGTTTAGTGAGAAAAGGCATAAACTTGAGGG
GGATGTTCGCGCTATGGAGTCGTATAAGAAGGAGGCGTCGCAGTTGCGTGGTGAAGTTCAGAAGCTGAATGAGATTAAAC
GTGAATTAAGTGGAAATGTTCAGATGCTTAGGAAAGATTTGGCTAAATTGCAATCAGATAACAAGCAGATTCCGGGTATG
AGAGCTGAGGTTAAAGACCTGCAGAAGGAGCTTATGCATGCTAGAGATGCAATTGACTATGAGAAGAAGGAAAAGTTTGA
GCTTATGGAGCAGCGGCAGACAATGGAAAAGAACATGGTTTCTATGGCCCGTGAAGTTGAAAAGCTACGAGCAGAACTTG
CTACTGTTGATAGTAGGCCTTGGGGTTTTGGTGGATCGTATGGGATGAATTTCAACAATATGGATGGCACTTTCCGTGGT
TCTTATGGTGAAAACGATAGTTATTTGGGATCTTCGGAAAGGAGTCAATATTACAGCCATGGGTCTGGCTCGCAGAAGAA
ACCTCGTTTGGATCGTCATTGA