Details for Lyrate rockcress Locus 16036114

Position : sca3 ( 5`- 7633193 .. 7635865 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036114

Protein [Map View]
MERDFLGLGSKNSPITVKEETSESSRDSAPSRGMNWSFSNKVSAASSQFLSFRPSQEDRHRKSGNYHLPHSGSFMPSSVA
DVYDSNRKAPYSTVQGVRMFPNSNQHEDTNAVSMSMPGFQSHHYAPGGRSFINNNNNSQPLVGVPIMAPPISILPPPGSI
VGTTDIRSSSKPIGSPAQLTIFYAGSVCVYDDISPDKAKAIMLLAGNGSSMPRAFSPPQTHQQVVHHARASVDSSAMPPS
FMPTISYLSPEAGSSTNGLRATRGLTSTPVAVPCSTNVIAPTVALPLARKASLARFLEKRKERVTSVSPYCLDKKSSTDC
RRSISECISSSLSSAT*

DNA
ATGGAGAGAGATTTTCTCGGGTTGGGTTCGAAAAATTCTCCGATCACGGTCAAGGAGGAAACCAGCGAAAGCTCTAGAGA
TTCAGCTCCCAGTAGAGGAATGAATTGGTCGTTCTCAAACAAAGTATCTGCTGCTTCTTCTCAGTTTCTATCTTTCAGGC
CATCTCAAGAAGATAGACATAGAAAGTCTGGAAATTATCATCTGCCTCACTCTGGTTCCTTCATGCCATCATCAGTAGCT
GATGTATATGATTCAAACCGCAAAGCTCCTTACAGTACTGTACAGGGAGTGAGGATGTTCCCTAATTCCAATCAACACGA
AGACACTAACGCAGTTTCCATGTCCATGCCGGGTTTCCAGTCTCATCATTATGCACCAGGAGGAAGAAGCTTCATCAACA
ATAACAATAACTCACAACCTTTGGTAGGAGTTCCTATCATGGCACCTCCAATTTCAATCCTTCCTCCCCCAGGTTCCATT
GTAGGGACTACTGATATTAGATCTTCTTCCAAGCCAATAGGGTCACCTGCACAGTTGACCATCTTTTATGCCGGTTCAGT
TTGTGTTTACGATGACATATCTCCTGATAAGGCAAAAGCGATAATGTTGCTAGCTGGGAACGGTTCCTCTATGCCTCGAG
CCTTTTCACCGCCTCAAACTCATCAACAAGTGGTCCATCATGCTCGTGCCTCTGTGGATTCTTCAGCTATGCCTCCTAGC
TTCATGCCTACAATATCTTATCTTAGCCCTGAAGCTGGAAGTAGCACAAACGGACTCAGAGCAACAAGAGGCTTGACATC
AACCCCAGTAGCAGTTCCTTGTTCTACCAATGTAATAGCTCCAACAGTGGCTTTACCTCTGGCTCGCAAAGCATCTCTGG
CTAGGTTTTTAGAGAAACGCAAAGAAAGGGTCACGAGCGTATCGCCATATTGCTTAGACAAGAAGTCATCGACAGATTGT
CGCAGATCAATATCAGAATGCATTAGTTCTTCTCTCAGCTCTGCAACCTAA