Details for Lyrate rockcress Locus 16036109

Position : sca3 ( 5`- 4590694 .. 4592557 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478481 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16036109

Protein [Map View]
MSYTTTTVDSDDGMHSSIHNESPAADSISNGCRSRGKSRVLKKGPWTSTEDGILIDYVKKHGEGNWNAVQKHTSLARCGK
SCRLRWANHLRPNLKKGAFSQEEEQLIVEMHAKMGNKWAQMAEHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEIHVED
FQWSEEYTKSNIIRVDRRRHQDFLQLGNSKANVLFDDLNFAASLLPAASDLSDLVACNMLGTGPSSSRYESYMPPILPSP
RQIWESGSRFPMCSSNIKHEFQSPEHFQNTASQKNPRSCSISPCDVDHPPYGNQHLSDMMIPDSHTLMYGMLPTSKPSFG
AVKLELPSFQYSETSAFDQWKTTPSPPHSDLLDSVDAYIQSPPSSQVEESDCFSSCDTGLLDMLLHEAKIKTSAKHSLLM
SSPQKSFSSTTCTTNVTQNVPRGGTLIKSGEYEDSQKNLTRSEITMPMQLSAGGISSAFAGNVVKTEEFDQVWEPKRVDT
TRPDVLLASSWLDQGCFGIVRDTSSMSDALALLLGGDDTGNSYVTVGSSSGQTPRGVGSCGWTNMPPVWSL*

DNA
ATGAGTTACACAACAACCACGGTTGATAGTGATGATGGTATGCACTCCAGCATCCATAATGAATCACCAGCTGCTGATAG
TATTAGCAATGGCTGCAGAAGTAGAGGGAAAAGCCGTGTCCTGAAGAAAGGACCATGGACTTCAACTGAAGACGGGATTT
TAATTGATTATGTAAAGAAGCATGGCGAGGGTAACTGGAATGCTGTGCAGAAACACACGAGCCTGGCCCGTTGTGGTAAA
AGCTGTCGTCTGAGATGGGCTAATCATCTGAGGCCAAACTTGAAGAAAGGAGCATTTAGCCAAGAAGAAGAACAGCTCAT
TGTTGAAATGCACGCCAAGATGGGAAATAAATGGGCACAGATGGCTGAACATTTACCTGGTCGAACAGATAATGAGATAA
AGAATTATTGGAACACTCGTATCAAGAGGAGACAACGTGCAGGCTTACCACTTTACCCTCCTGAAATCCATGTTGAAGAC
TTTCAGTGGAGCGAAGAGTATACAAAGAGTAATATCATAAGAGTAGATAGAAGAAGACATCAAGATTTCTTGCAGTTGGG
GAATTCCAAAGCTAATGTCTTATTTGATGATCTAAATTTTGCTGCTAGCTTGTTACCTGCCGCTTCTGACCTATCAGATT
TGGTTGCATGCAACATGCTAGGAACTGGCCCAAGTTCTTCCCGGTATGAAAGCTACATGCCACCAATATTGCCTTCCCCA
AGGCAAATCTGGGAATCTGGATCTCGGTTTCCTATGTGCAGCAGTAACATAAAGCATGAATTCCAATCTCCGGAACACTT
TCAGAATACTGCTTCACAGAAGAATCCCAGATCTTGCAGTATCTCGCCTTGTGATGTTGATCATCCTCCTTACGGAAACC
AACATTTATCTGATATGATGATTCCAGATAGCCATACCCTTATGTATGGCATGCTTCCTACTTCTAAGCCCTCGTTTGGG
GCAGTGAAGCTGGAGCTCCCTTCATTCCAATATTCAGAAACTAGTGCATTTGATCAGTGGAAGACGACACCGTCACCTCC
ACACTCAGATCTCCTTGACTCTGTTGATGCCTATATTCAATCTCCACCATCATCGCAGGTAGAGGAGTCAGATTGTTTCT
CTTCATGCGACACCGGCCTACTAGATATGTTACTTCATGAGGCCAAGATCAAAACTAGTGCGAAGCACAGTTTGTTGATG
TCATCACCCCAGAAGAGTTTCAGTTCAACTACTTGCACGACCAATGTTACTCAGAATGTACCACGTGGCGGCACACTGAT
CAAATCAGGTGAATATGAAGATTCCCAAAAGAATTTGACTCGCTCTGAGATTACAATGCCCATGCAACTTAGCGCAGGTG
GAATTTCATCAGCTTTTGCAGGGAATGTTGTAAAGACAGAAGAGTTTGATCAGGTTTGGGAACCAAAGAGAGTTGATACT
ACACGGCCTGATGTTTTACTTGCGTCGAGCTGGCTTGACCAAGGCTGTTTTGGGATTGTTAGAGATACAAGCAGCATGAG
CGATGCGCTTGCGCTTCTTCTTGGTGGTGACGACACTGGGAACAGTTACGTGACTGTTGGGTCATCATCAGGTCAAACAC
CACGAGGCGTCGGGTCTTGTGGATGGACTAATATGCCTCCCGTTTGGTCGTTGTAA