Details for Lyrate rockcress Locus 16036093

Position : sca3 ( 5`- 5310437 .. 5306808 -3` )
Annotation : [B2G] nol1 nop2 sun family protein
External links : CoGe
PGDD synteny : 16036093

Protein [Map View]
MAQLLSFRVYLSAETQKASPGSFKRTPKTRKPFSQDRRGPGAPSRKPQNLNLEVSPHRAVSAVRLMRIEYGGAFADLLNE
KGKGSGSNEMSYVERTIGFRTRDLDDRDLRLVSVADVVGGTIRWRRYLDHLIGSLCHNERTFRNMEPLLLQILRIGVYEI
IKRDMPPYAVVDENVRLAKVALRPGAGDFVNGILRKLVSLKEKDALPLPKVEGDDRAQARALATLHSHPVWMVRRWVKYL
GLEEATTLMTWNNNDPGFSLRANTGRGIARSDLVERLNSLKVPHELSLHLEEFVRIKTGLQTVVQAGLLKEGICSVQDES
AGLIVSVVKPQPGERIMDACAAPGGKTLFMASCLKGQGMIYAMDVNEGRLRILGETAKSHQVDGLITTIHSDLRVFAVTS
EVQYDKVLLDAPCSGLGVLSKRADLRWNRKLEDMVELTELQDDLLDSASKLVKHGGVLIYSTCSIDPEENEGRVEAFLER
HPVFSIDPVTSFVPSSFVTSQGFFLSNPVKHSLDGAFAARLVRAL*

DNA
ATGGCGCAATTGCTCTCATTCCGTGTGTATCTATCTGCTGAAACGCAGAAAGCTTCTCCAGGGTCTTTTAAGCGAACCCC
AAAGACTCGAAAACCCTTTTCGCAAGATAGAAGAGGTCCGGGGGCTCCGTCGCGGAAGCCCCAGAATCTGAATTTGGAGG
TTTCTCCACATAGAGCTGTATCTGCAGTCAGATTGATGAGAATTGAGTACGGTGGTGCGTTTGCTGATCTTCTGAATGAG
AAAGGAAAAGGGTCTGGGAGCAATGAGATGAGTTATGTTGAGAGGACAATCGGTTTTCGGACTCGCGATTTGGATGACCG
GGATCTTAGACTGGTTAGTGTTGCTGATGTTGTTGGAGGAACAATACGTTGGAGGAGATATCTTGATCATTTGATTGGTT
CCCTTTGCCACAACGAAAGAACATTTCGAAATATGGAACCTCTTCTATTGCAGATTCTCCGCATTGGTGTATATGAGATC
ATTAAGCGTGATATGCCGCCATATGCTGTTGTTGATGAGAACGTAAGGCTTGCAAAGGTTGCCCTCAGACCTGGTGCTGG
AGATTTTGTCAATGGGATTCTTCGTAAGCTTGTCTCTCTTAAGGAAAAAGACGCCCTTCCATTACCCAAAGTGGAAGGGG
ATGATCGTGCACAAGCACGTGCACTTGCTACTCTTCATTCACATCCTGTTTGGATGGTTAGGCGATGGGTAAAGTATCTT
GGGTTGGAAGAAGCCACAACGCTGATGACATGGAACAACAATGATCCTGGATTTAGCTTAAGAGCCAATACGGGAAGGGG
CATTGCAAGATCAGACCTTGTGGAGCGTCTAAACAGTTTAAAGGTTCCACACGAGCTGTCCTTACATTTGGAGGAATTTG
TCCGCATCAAAACAGGCTTGCAGACCGTTGTGCAAGCTGGTTTACTGAAAGAAGGCATCTGTTCAGTTCAGGATGAGAGT
GCAGGACTAATAGTCTCAGTGGTGAAACCTCAGCCAGGCGAGAGGATAATGGATGCATGTGCTGCTCCTGGAGGAAAGAC
CCTATTCATGGCATCTTGCTTGAAAGGCCAAGGTATGATATATGCTATGGATGTGAATGAAGGACGGCTGAGAATTCTTG
GTGAGACTGCAAAATCACACCAAGTTGATGGACTTATCACAACCATTCATTCCGATCTTCGTGTCTTTGCTGTAACCAGT
GAGGTACAATATGACAAAGTTTTGCTAGATGCCCCGTGTTCTGGACTCGGCGTCCTCTCCAAGAGAGCAGACTTGCGATG
GAACCGTAAACTTGAGGACATGGTAGAGCTCACAGAACTGCAGGATGATCTTCTTGATTCTGCCTCCAAACTGGTGAAGC
ACGGTGGGGTCTTGATATACAGTACTTGCTCTATAGACCCTGAAGAAAATGAAGGAAGGGTCGAAGCATTTCTCGAAAGA
CATCCTGTATTCTCCATAGATCCAGTAACCAGTTTCGTACCGTCGAGTTTTGTAACCTCGCAAGGCTTCTTTTTATCAAA
CCCAGTGAAGCACTCATTAGATGGAGCATTTGCAGCTCGTCTGGTTCGAGCCTTGTGA