Details for Lyrate rockcress Locus 16036082

Position : sca3 ( 5`- 6601331 .. 6600010 -3` )
Annotation : [B2G] glutaredoxin family protein
External links : CoGe
PGDD synteny : 16036082

Protein [Map View]
MAASLSTRLLKGIANLQAVRSSRLTSASVYQNGMMRFSSTVPSDSDTHDDFKPTQKAPSGSTDSLKDIVENDVKDNPVMI
YMKGVPESPQCGFSSLAVRVLQQYNVPISSRNILEDQELKNAVKSFSHWPTFPQIFIKGEFIGGSDIILNMHKEGELEQK
LKDVSGNQD*

DNA
ATGGCGGCTTCTTTATCGACCAGACTTCTTAAAGGAATCGCTAACCTCCAAGCTGTTCGTTCTAGCAGATTGACATCTGC
ATCAGTCTACCAAAATGGGATGATGAGATTTTCCTCTACAGTGCCAAGTGATTCAGACACACATGATGATTTCAAGCCTA
CACAAAAAGCTCCTTCTGGTTCTACGGACTCGCTCAAAGATATTGTTGAGAATGATGTGAAGGATAATCCTGTTATGATC
TACATGAAAGGTGTCCCTGAATCTCCTCAGTGTGGGTTTAGCTCACTCGCCGTCAGAGTTTTGCAGCAATATAATGTTCC
CATAAGTTCTAGAAACATTTTAGAAGACCAAGAGTTGAAAAACGCTGTGAAATCTTTCAGCCACTGGCCTACGTTTCCAC
AGATCTTCATAAAGGGAGAGTTCATTGGCGGCTCAGACATCATTCTTAACATGCACAAGGAAGGTGAATTGGAGCAGAAG
CTTAAAGACGTCTCCGGAAACCAAGATTGA