Details for Lyrate rockcress Locus 16036073

Position : sca3 ( 5`- 8833964 .. 8834320 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036073

Protein [Map View]
MISLSFIVRLANQENRRNRRYETNIKDRLISGELSDGSRPARDQNDVPRGHLAVYVGREERQRFVIPTKYLQYPEFRTLM
DEVADEFGYDHEGGIHIPCEESVFEEILIRYMSCDKKK*

DNA
ATGATTTCGCTAAGTTTCATCGTTCGTCTAGCAAACCAGGAGAACAGACGAAACAGAAGGTACGAAACTAACATTAAGGA
TCGTCTTATCTCGGGGGAGTTATCGGACGGTAGCAGACCAGCCAGAGATCAAAACGATGTCCCGAGAGGGCATCTTGCGG
TCTATGTGGGACGCGAAGAGAGGCAAAGGTTTGTGATACCGACCAAGTATCTTCAATATCCTGAATTTAGGACTTTGATG
GATGAAGTAGCGGACGAGTTTGGGTACGATCATGAAGGAGGGATTCATATTCCTTGTGAAGAAAGTGTTTTTGAAGAGAT
TTTGATTAGATACATGTCTTGTGACAAGAAGAAATAA