Details for Lyrate rockcress Locus 16036070

Position : sca3 ( 5`- 8016863 .. 8018952 -3` )
Annotation : [B2G] aspartate glutamate uridylate kinase family protein
External links : CoGe
PGDD synteny : 16036070

Protein [Map View]
MAIPLPLTSCSPISTSSSISRTSFVPLTPRNRTFFSNQNCSRRVLISCSSSDNGSSPDSMNGSGNGSSLNGQTSFPRMPS
FDGASKPPLKWRRVLLKVSGEALAGDEEQNIDPKVTMAIAREVAAVTRLGIEVAIVVGGGNIFRGSTWAGCSGLDRSSAD
YIGMLATVMNAIFLQATMESIGIPTRVQTAFRMSEVAEPYIRRRAIRHLEKGRVVIFAAGTGNPFFTTDTAAALRCAEIN
AEVVLKATNVDGVFDDDPKRNPNARLLDSLTYQEVTSKDLSVMDMTAITLCQENNIPVVVFNLSEPGNIAKAIKGERVGT
LIGGTWNSIVTTTT*

DNA
ATGGCAATTCCGTTGCCTCTCACCTCTTGCTCGCCAATCTCAACTTCTTCTTCTATTTCCCGAACCTCCTTCGTCCCTCT
CACACCTCGCAATCGTACTTTCTTCTCCAACCAGAATTGCAGCAGGCGTGTACTTATCAGCTGCTCTTCTTCAGACAATG
GTTCATCTCCAGATTCCATGAACGGAAGCGGGAACGGGAGTAGCTTAAACGGGCAGACATCTTTTCCACGAATGCCTTCC
TTTGATGGAGCATCCAAACCACCGCTTAAATGGAGAAGGGTTTTACTCAAAGTCAGTGGAGAAGCTCTTGCTGGAGACGA
GGAACAAAATATCGATCCAAAGGTTACTATGGCGATTGCAAGGGAAGTTGCAGCAGTGACTCGACTTGGCATTGAGGTTG
CAATTGTTGTTGGAGGAGGAAATATCTTTCGTGGATCTACCTGGGCTGGGTGCAGTGGCCTTGATCGCTCCTCTGCTGAT
TATATTGGGATGCTGGCAACTGTGATGAATGCAATATTTCTTCAAGCAACAATGGAGAGTATTGGCATCCCAACCCGTGT
TCAAACCGCTTTCCGCATGTCAGAAGTAGCAGAGCCTTACATAAGAAGACGAGCAATTAGGCATCTAGAAAAAGGAAGGG
TTGTTATATTTGCAGCTGGAACAGGCAATCCATTTTTCACCACCGATACTGCAGCAGCTCTTCGATGTGCTGAAATTAAT
GCAGAAGTAGTGCTGAAAGCAACAAATGTTGATGGAGTGTTCGACGATGATCCTAAAAGAAACCCAAACGCTCGCCTTCT
CGACTCACTAACTTACCAAGAAGTAACCTCAAAGGACCTCTCTGTAATGGATATGACTGCTATCACTTTGTGCCAAGAAA
ATAACATCCCAGTTGTGGTATTCAATCTATCGGAACCTGGAAACATCGCAAAAGCAATCAAAGGAGAGAGAGTCGGTACA
TTGATAGGAGGAACTTGGAACTCTATTGTTACAACTACTACATGA