Details for Lyrate rockcress Locus 16036057

Position : sca3 ( 5`- 8627909 .. 8631546 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036057

Protein [Map View]
MTTTTPEKTPARPLSIHDWDVLIDDFRDAGAPRDWFTSVFQIDSLVDFALSSLLKKDFPTPVKLSILVFLDEFSPILFDK
CGNDTFDRFIDVLRAIVQSPTDGSSGFKEQAMVSFTSVLVSIDSFSVGHVEAVVDLLLALVNRPNHGFDRQARAIACECL
RQLEKAFPGLLSDVAGHLWSLCQAERTHAVQAYLLLFTTIVYNVVNQKLKVSLLSTSVPLVPFNAPNWMRDQSLIMSHGQ
GLGPDQKELRRTLAFMLESPYLFTSCAMMEFMGMVVPLASALELQASMLKVQFLGMIYSFDPMLCHVVLLVYSQFPDAFE
GQEKEIMRRLMLFSKETQIYLVFRLLALHWLMGLLNKLMLSGELEKRKSVLEMGQKFHPVVFDPLALKALKLDLLVQCSV
SSNALSGGDNSKSAGDLLQDCLVSVSDFKWLPSWSSETELAFRTLHKFLICASTHSDSDPSTTRSLMESSLFQNVQGLLV
DMTLEFQILVPVIVAFIERLIHCHKHQWLGERFLQTVDENLLPKLKKKNLLTAYFPLFHRIAENDTIPPSRLIELLTKFV
ISLVEKRGFDVGLKLWDQGTEVLGICRTLMSHHKSSRLFLGLSRLLSLTCLYFPDLEVRDNARIYLRMLVCIPGQRIKNI
LKPADAVSPSTHSSTFFSVQSPRFRHDPSKSRNLSSYIHLERVTPLLVKQSWSLSLPSLSVGTDGYSIIENKIQVDEVEP
DGSQELQILPEARRIESGKPTLRVMDSKIAEILERLRRYFSVIPDFKHMPGIKVRITCTLRLDAEPYSSIWGSESQKIDL
EKVDSPPAIFATVLKFSSSAPYGSIPSCRIPFLLGEPHWNSNVPNEEVSLDIVLVENTLKEEEKDGLRGAPVTVELEPRE
PTPGLVEVSMEANAENGQMIQGKLESVPVGIEDMFLKALAPVDEPEDTIPSYYSDLFNALWEVCGSSSSTAHETFALKGG
KTAAAVSGTRSVKLLEVPAEIVIQATELRLAPFVVAISGEQLVNIVRDGGIIENIVWKEEEEEQGDRANADQSSSSSVGL
NRGPLRLTYIGYGDDQEVPMTRSRGKMGKIKMLMFLPPRYHLMFEMEVGEGSTLVHIRTDYWPCLAYVDDYLEALFLQ*

DNA
ATGACCACGACGACGCCGGAGAAGACTCCGGCGAGACCTCTCTCTATCCATGATTGGGACGTTCTCATCGACGACTTCCG
AGACGCCGGCGCTCCTCGCGACTGGTTCACTTCCGTTTTCCAGATTGATTCTCTGGTAGACTTCGCTCTCTCGTCTCTCC
TCAAGAAAGACTTTCCTACGCCGGTGAAGCTCTCAATCCTTGTCTTTCTCGACGAATTTTCCCCGATTTTGTTTGATAAA
TGTGGTAACGACACCTTTGATCGCTTCATCGATGTTCTCCGTGCGATTGTACAATCTCCGACTGATGGATCTTCCGGATT
TAAAGAGCAAGCTATGGTCTCTTTTACGTCTGTGCTTGTATCGATTGATTCTTTCTCTGTAGGTCACGTTGAAGCAGTTG
TTGATTTACTTCTTGCGCTCGTTAATCGTCCTAACCACGGCTTTGATCGACAAGCTCGTGCTATCGCCTGTGAGTGTTTA
CGTCAGCTTGAGAAAGCATTTCCTGGTTTGCTATCTGATGTCGCTGGTCATCTTTGGTCGTTGTGTCAAGCGGAGAGAAC
TCACGCCGTGCAAGCTTATCTTCTCTTGTTCACTACAATTGTCTACAATGTGGTTAATCAGAAGCTTAAGGTTTCACTTC
TTAGTACCTCTGTACCATTGGTGCCTTTTAATGCTCCTAATTGGATGCGTGATCAGAGTTTGATTATGAGTCATGGTCAA
GGGTTGGGGCCAGATCAAAAGGAACTGAGACGAACATTGGCTTTTATGTTGGAATCTCCGTATTTGTTCACGTCTTGTGC
TATGATGGAATTTATGGGTATGGTTGTGCCACTTGCGTCGGCGTTGGAGTTACAGGCCTCTATGTTGAAAGTTCAGTTCT
TGGGGATGATTTATTCGTTTGATCCAATGCTTTGTCATGTTGTCTTGCTTGTGTATTCTCAGTTCCCTGATGCGTTTGAG
GGACAAGAGAAAGAGATCATGAGACGTCTTATGCTCTTTTCCAAGGAGACTCAGATCTATCTTGTTTTCCGCTTGCTTGC
ACTGCACTGGTTAATGGGTTTGTTGAATAAGCTTATGCTGAGTGGGGAGCTTGAGAAGAGGAAATCTGTTCTTGAGATGG
GTCAGAAGTTTCATCCTGTAGTTTTTGATCCACTCGCTTTGAAAGCGTTGAAGCTTGATCTGCTGGTACAATGCTCTGTT
AGTTCCAACGCTTTGAGTGGAGGTGATAACAGTAAGTCTGCTGGAGATCTGTTGCAGGACTGCTTGGTATCGGTTTCGGA
TTTCAAATGGTTGCCTTCATGGAGCTCAGAAACTGAACTAGCATTCCGCACTTTACACAAGTTTCTGATATGTGCATCTA
CACATTCCGACTCTGACCCTTCCACCACTAGAAGCCTTATGGAGTCTAGCCTCTTCCAAAACGTGCAGGGGTTGCTGGTA
GACATGACTTTGGAGTTTCAAATCTTGGTCCCTGTTATTGTGGCTTTTATTGAGCGGTTGATACACTGTCACAAGCATCA
GTGGTTAGGAGAGCGGTTTCTTCAGACAGTCGATGAGAATCTGCTTCCCAAACTTAAGAAAAAAAACTTATTAACAGCTT
ACTTCCCGCTTTTCCATCGGATAGCCGAGAATGATACAATACCTCCTTCTCGATTGATAGAGCTGCTTACGAAGTTTGTA
ATTTCACTTGTTGAGAAGCGCGGGTTTGATGTGGGGTTGAAATTGTGGGATCAAGGAACTGAAGTTCTTGGCATTTGTCG
AACACTGATGAGTCACCATAAGAGCTCTAGATTATTTCTTGGACTTTCTCGCCTTCTTTCCCTCACATGTCTCTATTTCC
CTGATCTGGAGGTCCGAGACAATGCTAGGATATATCTGAGGATGCTGGTCTGTATACCAGGACAGAGAATTAAGAACATA
TTGAAGCCCGCAGATGCTGTCTCTCCATCAACCCATTCTTCTACATTCTTTAGTGTTCAAAGTCCTCGTTTTCGTCATGA
TCCTAGTAAATCTCGGAACCTTTCATCCTATATTCATCTTGAACGGGTTACGCCCCTACTCGTGAAACAGTCATGGTCAT
TGTCTCTACCATCTCTAAGTGTTGGAACTGATGGATATAGCATTATAGAAAACAAAATCCAGGTAGATGAAGTTGAGCCG
GATGGCAGTCAAGAACTTCAGATTTTGCCAGAAGCTCGAAGAATTGAATCAGGAAAACCTACGTTAAGGGTAATGGACTC
AAAGATTGCAGAGATTCTAGAAAGATTAAGAAGATATTTCTCTGTGATTCCTGATTTCAAACACATGCCTGGAATTAAGG
TTAGAATAACGTGTACTTTGAGATTGGATGCTGAACCATATAGCAGTATATGGGGAAGTGAAAGTCAGAAAATCGATTTA
GAGAAAGTCGACTCACCTCCTGCGATTTTCGCGACCGTACTCAAATTCTCATCTTCAGCCCCGTATGGCTCTATTCCCTC
ATGCCGCATACCTTTCCTTCTTGGTGAGCCTCATTGGAACAGCAATGTACCCAATGAAGAAGTTTCTTTAGACATCGTCC
TGGTAGAAAACACACTGAAAGAGGAGGAAAAAGATGGCTTGAGAGGAGCACCTGTAACAGTGGAACTGGAACCTAGAGAA
CCTACACCAGGTTTGGTCGAGGTTTCAATGGAAGCAAATGCAGAGAATGGTCAGATGATTCAGGGAAAACTCGAGAGTGT
CCCTGTGGGTATCGAAGACATGTTCCTAAAAGCTCTTGCTCCAGTGGACGAACCTGAAGATACAATACCGAGCTACTACT
CAGATCTATTCAATGCTTTGTGGGAAGTGTGTGGTTCTTCATCCAGCACCGCACACGAAACATTTGCACTAAAAGGTGGC
AAAACGGCTGCAGCAGTCAGCGGGACTCGGTCAGTAAAACTGCTTGAAGTCCCTGCGGAAATTGTAATACAGGCCACTGA
GCTTCGCTTAGCGCCCTTTGTTGTGGCTATCAGCGGAGAACAGCTTGTAAACATTGTAAGAGACGGAGGAATCATCGAGA
ACATTGTGTGGAAGGAAGAGGAAGAAGAACAAGGGGATCGCGCAAATGCGGACCAGTCTTCTTCATCCTCGGTGGGATTA
AACCGAGGCCCTCTTCGTCTGACATACATTGGATATGGAGATGACCAAGAGGTTCCGATGACGAGGAGCAGAGGGAAAAT
GGGAAAGATAAAGATGCTGATGTTTCTTCCTCCGAGATATCATCTGATGTTTGAAATGGAAGTTGGTGAAGGATCGACAT
TGGTGCATATAAGAACAGATTATTGGCCTTGCTTAGCTTATGTTGATGATTACTTAGAAGCTTTGTTTTTGCAATAG