Details for Lyrate rockcress Locus 16036049

Position : sca3 ( 5`- 10091881 .. 10090971 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036049

Protein [Map View]
MLKKRSRSKQALMAEPNQSQNQKQSKPTPFPRLFTAFSSFKSFTENDAVASPTSILDTKPFSVLKNPFGSDNPKTHEPET
RLRLEPKRIGLAIVDSLIQDETPEPGPRSGTILFGSQLRIRVQDSPRSSSDFGIKTRNSQPETKKPDPGSGLGSPRIISG
YFSASDMELSEDYTCVTCHGPNPRTIHIFDNCIVESQPGVVLFRRSDPVNESDPDYSPPDSFLSSCCNCKKSLGPRDDIF
MYRGDRAFCSSECRSIEMMMSEENDIK*

DNA
ATGCTAAAGAAGAGATCAAGAAGCAAGCAAGCTTTAATGGCGGAACCAAACCAGAGTCAGAATCAGAAACAGAGTAAACC
GACGCCGTTTCCAAGGCTATTCACAGCTTTTAGTAGCTTTAAAAGCTTCACTGAAAACGACGCCGTCGCGAGTCCAACTT
CGATTCTCGACACCAAACCTTTCTCTGTTTTGAAAAACCCTTTTGGATCCGATAACCCGAAAACCCACGAACCCGAAACC
CGTCTCAGACTCGAACCCAAAAGAATCGGACTCGCCATTGTCGATTCTTTAATCCAAGACGAAACACCCGAACCCGGACC
GAGATCCGGGACGATTCTATTCGGGTCTCAGCTTCGGATCCGGGTCCAGGATTCTCCACGTTCCTCGTCGGATTTCGGGA
TCAAAACGAGGAATTCTCAACCGGAGACGAAGAAGCCGGATCCCGGGTCGGGTCTTGGATCGCCCAGAATCATCTCCGGC
TATTTCTCGGCGAGCGATATGGAGTTATCGGAGGATTACACATGCGTGACGTGTCACGGGCCTAACCCGAGAACCATTCA
TATATTCGATAACTGTATCGTAGAGAGCCAACCCGGCGTCGTTTTATTCCGGAGATCCGACCCGGTTAACGAATCGGATC
CGGATTATTCCCCACCCGACAGTTTTCTCAGTTCTTGCTGTAACTGTAAGAAGAGTCTTGGACCTCGTGATGACATTTTC
ATGTACAGGGGAGATAGAGCTTTCTGTAGCAGTGAATGCAGGTCCATAGAGATGATGATGTCAGAGGAAAATGATATTAA
ATGA