Details for Lyrate rockcress Locus 16036005

Position : sca3 ( 5`- 10853148 .. 10853567 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036005

Protein [Map View]
MEKLSPFMDIASLEIESLRRIKRPKRFSEESETETMTSSNAVFGFPHLPEEPNRDLDQSVLCRIRVRLPDGRRIQRSFLK
SESVQLLWSFCYSQIDESERKRFKLIQAFPGEYKNLYFGSNTTFEESGLANSLVSVTWV*

DNA
ATGGAGAAATTATCACCGTTCATGGACATCGCCTCTTTGGAAATCGAGTCTCTACGAAGAATCAAACGCCCGAAACGCTT
CTCTGAAGAATCAGAAACCGAGACGATGACTTCATCAAACGCGGTTTTCGGATTCCCTCACTTACCAGAAGAACCAAATC
GCGATTTGGATCAAAGCGTTTTGTGTAGAATCCGCGTTCGATTACCAGATGGGAGAAGAATACAGAGGAGTTTCTTAAAG
AGTGAATCTGTTCAGCTTCTTTGGTCGTTTTGTTATTCGCAGATTGATGAATCTGAGAGAAAGCGTTTTAAATTGATTCA
AGCGTTTCCTGGGGAATATAAGAATCTTTATTTTGGATCTAATACGACTTTTGAAGAATCTGGGCTTGCGAATTCTTTGG
TTTCGGTTACTTGGGTCTGA