Details for Lyrate rockcress Locus 16036003

Position : sca3 ( 5`- 1318071 .. 1318874 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036003

Protein [Map View]
MSQHNILEALNVRVVGTGDRILFLAHGFGTDQSAWHLILPYFTQNYRVVLYDLVCAGSVNPDYFDFNRYTTLDPYVDDLL
NIVDSLGIQNCAYVGHSVSAMIGIIASIRRPELFSKLILIGFSPRFLNDEDYHGGFEEGEIEKVFSAMEANYEAWVHGFA
PLAVGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGFVRVPTCVIQTAKDVSVPASVAEYLRSHLGGDTTVE
TLKTEGHLPHLSAPAQLAQFLRRALPR*

DNA
ATGAGTCAACACAACATCTTAGAAGCTCTAAATGTCCGGGTCGTGGGTACGGGTGATCGGATCCTGTTTCTAGCCCATGG
ATTCGGTACTGACCAATCAGCTTGGCACTTAATCCTTCCTTACTTCACCCAAAACTACAGAGTCGTCCTCTATGACCTAG
TTTGCGCCGGCAGTGTCAATCCCGATTACTTCGATTTCAATCGTTACACAACTCTCGATCCTTACGTCGATGATCTTCTC
AACATCGTTGATTCACTCGGAATCCAAAACTGTGCTTACGTTGGTCACTCTGTTTCCGCTATGATCGGAATCATAGCTTC
GATTCGTCGGCCGGAGCTTTTCTCGAAGCTTATCTTGATCGGATTTTCACCTAGGTTTCTCAACGACGAGGATTATCACG
GAGGATTCGAAGAAGGTGAAATCGAGAAGGTTTTCTCAGCTATGGAAGCTAATTACGAAGCTTGGGTTCATGGATTTGCT
CCGCTTGCTGTTGGAGCTGATGTTCCGGCGGCTGTTAGAGAATTTAGCCGGACTTTGTTTAATATGCGTCCGGATATTTC
TCTGTTTGTTTCGAGGACGGTGTTCAACAGCGATCTGAGAGGTGTGCTTGGGTTCGTTAGAGTTCCGACGTGTGTAATTC
AGACGGCGAAGGATGTTTCGGTGCCGGCTTCGGTGGCGGAGTATCTTAGGTCTCATCTTGGTGGAGATACGACTGTGGAG
ACGCTTAAAACTGAAGGACATTTGCCGCATCTTAGTGCTCCGGCGCAGCTTGCTCAGTTTCTCCGGCGAGCTCTTCCTCG
GTGA