Details for Lyrate rockcress Locus 16035987

Position : sca3 ( 5`- 5345792 .. 5344857 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16035987

Protein [Map View]
MFNQSSSVSLLYVVEIAKTTQNVDVTWSKTMSSHSLTIKIENLKDEQHNHHQPVKIDLSGSSFWAKKGLKSLEANGARVD
VYWDFRQAKFSNFPEPSSGFYVSLVSQNATILTMGDLKNEALKRTKKNPSATEAALVSKQEHVHGKRVFYTRTAFGGGES
RRENEVVIETSLSGPSDPEMWITVDGVPAIRIMNLNWRFRGNEVLTVSDGVSLEIFWDVHDWLFETSGSSSGLFVFKPKA
GFESKSLSFNGGYGDGEGEDHDVEDDDSSPKYCHVLYAVKELEFPCGPCQKI*

DNA
ATGTTTAATCAATCCAGCTCTGTCTCGTTACTCTACGTAGTTGAAATCGCCAAAACTACACAAAACGTAGACGTCACTTG
GTCCAAAACCATGTCATCACATTCCTTGACCATCAAAATCGAGAATCTCAAAGACGAGCAACATAATCATCATCAACCGG
TGAAGATAGATCTTTCAGGATCTTCATTTTGGGCCAAAAAGGGTCTCAAGAGTTTAGAAGCTAACGGGGCTAGGGTTGAC
GTATACTGGGATTTTCGTCAGGCCAAATTCTCAAACTTCCCTGAACCTTCCTCTGGCTTCTACGTCTCTCTCGTATCCCA
AAACGCAACCATTTTAACGATGGGGGATTTAAAGAACGAAGCTTTGAAGAGGACAAAGAAGAACCCTTCAGCCACAGAAG
CTGCCTTGGTCTCCAAGCAAGAACACGTCCACGGAAAACGTGTTTTCTACACGCGGACGGCGTTTGGTGGTGGAGAGTCG
CGTCGGGAGAACGAGGTGGTGATCGAGACATCTCTGTCGGGTCCTAGCGATCCAGAGATGTGGATCACGGTGGACGGTGT
GCCGGCGATTAGGATCATGAATTTGAATTGGAGATTTAGAGGGAATGAGGTTTTGACTGTGAGTGATGGTGTTTCTTTGG
AGATCTTTTGGGACGTTCATGATTGGCTGTTTGAAACCTCTGGTTCGTCTAGTGGGTTGTTTGTTTTCAAGCCTAAAGCT
GGATTCGAATCTAAAAGTCTTAGCTTTAATGGTGGCTATGGTGATGGTGAAGGTGAGGATCATGATGTGGAAGATGACGA
TTCGTCGCCCAAGTATTGTCATGTTCTATATGCTGTCAAAGAACTAGAATTTCCATGTGGACCATGTCAAAAAATTTAG