Details for Lyrate rockcress Locus 16035900

Position : sca3 ( 5`- 10575106 .. 10573520 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16035900

Protein [Map View]
MVSEAWIVKMRNQVSANLKHALLLESSTKKTPKSSSLPKQTIGILSFEVANIMSKTIHLHRSLSDTEISKLKSEVFRSEG
VRNLVSSDENHLLDLAVSEKLDDLSRVASVVSRLGKKCNEPALQGFEHVYEDIVNGVIDFRKLGFLVKDMESMVKKMERF
VNATCSLYCEMEVMNELEQAIVKLQRSQQHQESVKAFEQKLMWQRQDVRGLRDGSLWNQTYDKVVEMLARTVCTIYGRIE
TVFGGLGLRGKKDVTLKRDRSKNEASKVVNSRSVAGFKDSRRSEAEEFTRAGDFNFPCGTNPGRMFMECLAMNRTIGDDD
DDEDDARITFPLNTARMIRTSKFGFKSRLTQHASASTIGGSALSLHYANVVIVVEKLLKYPHLIGEEARDDLYQMLPTSL
KTTLKANLRSYLKNISIYDAPLAHDWKETIDGILSWLAPLAHNMIRWQSERNFEQNNQIVKRTNVLLLQTLYFAGREKTE
AAICKLLVGLNYICHYEQQQNALLDCASSFDYEDCFEWQSQCRAAYLD*

DNA
ATGGTTTCAGAAGCTTGGATTGTGAAAATGAGAAACCAAGTAAGTGCTAATCTCAAACACGCTCTTCTTCTTGAATCTTC
CACTAAGAAAACCCCTAAAAGCTCTTCTCTTCCTAAACAAACAATTGGAATCTTATCTTTCGAAGTAGCTAACATTATGT
CCAAAACCATTCACCTTCACCGTTCTCTGTCCGATACAGAGATCTCTAAGCTCAAATCCGAGGTTTTTCGGTCTGAAGGA
GTTAGAAATCTTGTTTCTTCCGATGAGAATCATCTTCTTGATCTCGCTGTCTCTGAGAAGCTTGATGATTTGAGCCGTGT
AGCTAGTGTTGTGTCTAGGTTAGGTAAGAAATGTAACGAACCTGCTTTACAAGGATTTGAGCATGTTTATGAAGATATAG
TGAATGGGGTTATTGATTTTAGGAAGTTAGGGTTCTTGGTTAAAGATATGGAATCTATGGTTAAGAAGATGGAGAGATTT
GTGAATGCTACTTGTAGTTTGTATTGTGAAATGGAAGTGATGAATGAGCTTGAACAAGCTATAGTGAAGCTTCAGAGAAG
TCAGCAACATCAAGAGAGTGTTAAAGCTTTTGAACAGAAGCTTATGTGGCAGAGACAAGACGTGAGAGGTCTTAGAGATG
GTTCGTTGTGGAACCAAACTTATGATAAGGTTGTTGAGATGTTGGCTAGAACTGTTTGTACTATTTATGGTAGGATTGAA
ACTGTTTTTGGTGGTTTGGGTTTGAGAGGGAAAAAGGATGTGACTTTGAAGAGAGATCGTAGCAAGAATGAAGCGAGTAA
GGTTGTTAACTCGAGGTCTGTTGCGGGGTTTAAGGATTCGAGGAGAAGTGAAGCAGAGGAGTTTACGCGTGCAGGGGATT
TCAATTTCCCTTGTGGGACTAATCCTGGTAGGATGTTTATGGAATGTCTTGCTATGAATAGGACTATTGGTGATGATGAT
GATGATGAAGATGATGCTCGGATTACATTTCCTTTGAATACAGCTCGGATGATTCGGACTAGTAAGTTTGGTTTTAAGAG
CAGGTTAACTCAACATGCTTCAGCTTCAACTATTGGAGGTTCTGCTTTATCTTTGCACTATGCGAATGTTGTGATTGTGG
TAGAGAAGCTTCTCAAGTACCCTCATCTAATAGGCGAAGAAGCAAGAGACGATCTTTACCAAATGTTACCAACGAGTTTG
AAAACAACGCTCAAAGCCAATCTTAGATCGTACTTGAAGAACATTTCGATCTACGACGCTCCTTTAGCTCATGATTGGAA
AGAAACAATAGACGGTATACTGTCCTGGCTTGCACCTTTAGCTCACAACATGATCCGGTGGCAGAGCGAACGCAACTTCG
AGCAGAATAATCAGATTGTGAAGCGAACGAATGTTCTTCTACTTCAGACGCTTTACTTTGCTGGTAGAGAGAAGACAGAA
GCTGCAATTTGTAAACTTCTTGTCGGGTTAAACTACATTTGCCATTACGAACAGCAACAAAACGCGTTGCTGGATTGCGC
GAGTAGCTTTGATTATGAAGATTGTTTCGAGTGGCAGAGCCAATGCCGTGCAGCTTACTTGGACTAA