Details for Lyrate rockcress Locus 16035672

Position : sca3 ( 5`- 1441271 .. 1440740 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477689 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16035672

Protein [Map View]
MATEGTEKTKSTEVKKKLNVLIVDDDPLNCRLHEMIIKTIGGISQTAKNGEEAVILHRGGASFDLILMDKEMPERDGVST
TKKLREMKVTSMIVGVTSLADQEEERKAFMEAGLNHCLEKPLTKAKILPLINHLLGA*

DNA
ATGGCAACAGAAGGTACTGAGAAAACTAAGTCAACAGAAGTGAAGAAGAAACTAAACGTGTTGATCGTCGATGATGATCC
ATTAAACTGTAGACTCCACGAGATGATCATCAAAACGATCGGAGGAATTTCTCAGACGGCAAAGAATGGTGAGGAGGCTG
TGATTCTCCACCGCGGTGGGGCATCTTTCGACCTTATTCTAATGGATAAGGAAATGCCCGAGAGGGATGGAGTTTCGACA
ACTAAGAAGCTAAGAGAAATGAAAGTGACGTCAATGATTGTTGGGGTAACGTCACTAGCTGACCAAGAAGAAGAGCGTAA
GGCTTTTATGGAAGCCGGACTTAACCATTGCTTGGAAAAACCCTTAACCAAGGCCAAGATCCTCCCTCTCATTAACCATC
TCCTGGGTGCTTGA