Details for Lyrate rockcress Locus 16035634

Position : sca5 ( 5`- 17894465 .. 17892029 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16035634

Protein [Map View]
MGDIQERLSVSSSSSSSSSSLSLSTAQPKADSLLIEEESWMIAEERAHEILCTIQPALVSDKSRNEIIDYVRTLIKSHDG
IEVFSFGSVPLKTYLPDGDIDLTVLTKQNMDDDFYGQLCSRLQNEERESEFHATDVQFIPAQVKVIKCNIRNIAVDISFN
QTAGLCALCFLEQVDQLFGRDHLFKRSIILVKAWCYYESRILGANTGLISTYALAVLVLYIINLFHSSLSGPLAVLYKFL
DYYGSFDWNNYCISVNGPVPISSLPELTAASPENGHELLLDEKFLRNCVELFSAPTKAVDSNGLDFPIKHLNIVDPLKYS
NNLGKSVTQGNVQRIRHAFTLGARKLRDVLSLPGDTMGWRLEKFFRNSLERNGKGQRQDVNDPVTAFGTGRSELSELSGD
FEGYFGRLVYGQIHGYSLPGTFQHGYIPVSSQVTDPSGWDIVRHLVTYRKNEFYLKSLNVSTSLPNGCQNMRRGTGTYIP
DMSQQVYSDRFRDSGTGTSSTHHLEASAEAIDNDGASSCCNLSGEVSTCTGNKGEECVRPETNSNPDQKPVLKSQRSEHL
EIDDNCQFPPPENLVEPLSSSTLVLENGKEENSRSSQTMNGS*

DNA
ATGGGTGATATTCAAGAAAGATTGTCAGTTTCATCATCTTCGTCTTCTTCATCATCCTCATTGTCACTATCAACAGCACA
ACCTAAAGCGGATTCATTGCTGATAGAGGAGGAATCTTGGATGATTGCAGAGGAGAGAGCTCATGAGATACTTTGCACTA
TCCAACCTGCCCTTGTTTCAGACAAAAGTAGGAATGAGATCATTGATTATGTACGAACTCTGATCAAGAGTCATGATGGA
ATTGAGGTCTTTTCATTTGGTTCAGTGCCACTAAAAACTTATCTCCCAGACGGAGATATCGACCTGACTGTCCTAACTAA
GCAAAATATGGACGACGATTTTTATGGACAATTATGCAGCCGGCTTCAAAATGAAGAAAGAGAATCTGAATTCCATGCAA
CAGATGTTCAATTTATCCCTGCACAGGTCAAGGTCATAAAATGCAATATCAGGAACATTGCTGTGGATATCTCTTTTAAT
CAAACGGCAGGTCTCTGTGCTTTATGTTTTCTCGAACAGGTTGACCAACTCTTTGGGAGAGATCATCTTTTCAAGCGTAG
CATCATCCTAGTCAAAGCTTGGTGCTATTACGAGAGTCGAATTCTTGGTGCTAACACTGGATTGATCTCAACATATGCAT
TGGCAGTACTAGTTTTGTACATCATCAACCTATTTCATTCATCTTTATCTGGCCCTTTAGCGGTTCTGTATAAGTTCTTG
GATTACTATGGTTCATTTGACTGGAACAACTACTGTATCAGTGTCAATGGTCCTGTGCCAATATCTTCCCTTCCAGAACT
TACGGCAGCTTCTCCAGAAAATGGGCATGAGTTATTGCTTGACGAGAAGTTTTTAAGAAACTGTGTAGAGTTATTTTCTG
CTCCAACTAAAGCTGTTGACTCAAATGGTCTTGATTTTCCTATCAAACATCTCAACATAGTCGATCCTCTAAAATACAGC
AACAACCTCGGAAAAAGTGTTACACAAGGAAATGTCCAACGAATAAGACATGCTTTTACACTTGGAGCTCGAAAGCTCAG
AGATGTTCTTTCATTACCTGGTGACACCATGGGATGGAGATTGGAGAAGTTCTTTCGTAACTCTTTGGAGAGAAATGGTA
AGGGACAAAGGCAAGATGTGAATGATCCCGTTACTGCGTTTGGTACTGGAAGATCAGAATTGTCTGAACTTAGTGGAGAT
TTCGAAGGTTACTTTGGAAGACTTGTGTATGGGCAAATTCATGGGTATAGCTTACCTGGAACATTTCAGCATGGCTATAT
CCCGGTTAGTTCTCAAGTTACGGACCCAAGTGGTTGGGATATTGTTCGTCACCTTGTGACTTACCGAAAGAACGAGTTTT
ATCTTAAAAGTCTCAATGTATCAACCTCTTTACCTAATGGCTGTCAAAACATGAGGAGAGGAACCGGCACATATATTCCT
GACATGAGTCAACAGGTATACTCTGACAGGTTCAGAGACTCAGGTACTGGAACCTCATCAACTCATCACTTAGAAGCTTC
CGCTGAGGCAATAGACAATGATGGAGCCAGTAGTTGCTGCAATCTTTCTGGTGAAGTGTCTACATGTACCGGTAACAAAG
GAGAAGAATGTGTGAGACCAGAGACTAATAGTAACCCAGATCAGAAGCCTGTGCTGAAATCTCAAAGATCTGAGCATTTG
GAGATTGATGACAATTGCCAATTTCCACCACCAGAAAACCTAGTAGAACCTCTATCTTCAAGCACATTGGTATTGGAAAA
TGGCAAAGAAGAGAACAGCAGATCCTCCCAAACCATGAACGGTTCTTGA