Details for Lyrate rockcress Locus 16035604

Position : sca3 ( 5`- 1593803 .. 1595297 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16035604

Protein [Map View]
MGREVVEVLMDRNADVSSGRVHVAPKIAAEETDEEFEVKECTEEKSLSENAPNVGSAERIGAQKSPKTRNGNAKVSKQQD
APLLPVRKPLQPENKKHIDDDDNCSIASSVATSTRMGKSGLTYGSAPTFRSAQRAEKRKEYYQKLEEKNQALEAERNELE
QRQKEEQEAALKQLRKNLKFKAKPVPNFYYEAPPAKAELKKLPLTRPKSPKLILSRRKSFSDAVSSSSREEVLKTVSTRN
RHSTGTVQNKEDQKNKNNNSAHDSPRVRSGKAKAALKPVTECSEEASEA*

DNA
ATGGGAAGAGAAGTCGTTGAGGTGCTTATGGACCGAAACGCCGACGTTTCAAGCGGTAGAGTTCACGTTGCTCCTAAGAT
AGCTGCAGAGGAGACTGATGAGGAATTTGAAGTCAAGGAATGCACAGAGGAGAAGTCTCTTTCTGAAAATGCACCAAACG
TTGGATCTGCTGAGAGAATTGGAGCTCAGAAATCGCCTAAAACTCGTAATGGAAATGCTAAAGTTTCAAAGCAGCAGGAT
GCTCCTCTTCTCCCGGTGAGGAAGCCATTGCAACCCGAGAACAAGAAGCATATCGATGACGATGATAATTGCTCCATTGC
TTCTTCCGTTGCAACTTCCACGAGGATGGGTAAGTCTGGATTGACTTATGGAAGTGCTCCAACGTTTAGGAGTGCTCAAC
GTGCTGAGAAACGCAAGGAGTATTACCAAAAGCTCGAGGAGAAAAACCAAGCGCTTGAAGCCGAAAGGAACGAGCTTGAA
CAGAGGCAAAAGGAAGAACAAGAAGCAGCCTTGAAACAACTTAGAAAGAATCTCAAGTTCAAGGCTAAACCCGTCCCCAA
CTTTTACTACGAGGCACCTCCTGCAAAAGCTGAGCTCAAGAAGCTTCCTTTGACGCGTCCCAAGTCGCCAAAACTCATCC
TTTCTCGGAGAAAAAGCTTCAGCGACGCCGTCAGCTCGTCTTCCCGTGAAGAGGTTCTGAAGACAGTCTCTACCCGGAAC
CGACACAGCACTGGAACAGTTCAGAACAAAGAAGATCAGAAGAACAAGAACAACAATTCTGCGCACGACAGCCCTCGTGT
CAGATCTGGTAAGGCTAAAGCCGCATTGAAACCAGTGACCGAGTGCTCAGAAGAAGCATCTGAGGCTTGA