Details for Lyrate rockcress Locus 16035594

Position : sca3 ( 5`- 1457169 .. 1456237 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16035594

Protein [Map View]
MANLLYLQLSSCVVRGRHCSINCDFDLCPSIVSRSSFKCRASRGPSWEEELFRDEGFARFEFGNRKKKRPWWFDDDDDDD
YDDWTDEEEDWSSVFEVFRTLSWMLAPIGISLLLGTDSNAGLMALAVPLVQSVLSLVVSKVWSRPSFRPMERSRRDSFSR
SANVSSARTRKARQGENMRGGVDKGGYKSWMVADADSNSMGTGYGGWDDLDTLREIRNDNPSNENVRQKQQSVKRASRRW
RVKEKPLLLRMLIAAFPFLGSWTKLLF*

DNA
ATGGCGAATCTGCTGTATCTTCAGCTTTCTTCTTGCGTAGTCAGAGGCAGACACTGTTCCATAAACTGCGATTTTGATCT
CTGCCCAAGTATCGTGAGCCGCAGTTCCTTTAAGTGCCGCGCCTCCCGTGGCCCTAGCTGGGAGGAGGAGCTCTTCCGAG
ACGAAGGTTTTGCTCGATTTGAGTTCGGAAACCGTAAAAAGAAAAGGCCTTGGTGGTTCGATGATGATGACGATGACGAT
TATGATGATTGGACAGATGAAGAAGAAGACTGGAGTTCAGTTTTTGAGGTATTTAGGACTTTGAGTTGGATGCTTGCACC
TATCGGTATATCTTTGCTTCTCGGAACAGATTCAAACGCGGGTTTAATGGCATTAGCTGTTCCTTTAGTTCAATCTGTGT
TGTCCCTTGTGGTTAGTAAGGTCTGGAGCAGGCCAAGCTTTAGACCTATGGAAAGAAGCAGAAGAGATTCATTTTCGAGA
TCTGCGAATGTAAGTAGTGCAAGAACAAGGAAAGCTAGGCAAGGAGAAAACATGAGGGGTGGTGTGGATAAGGGAGGATA
CAAGTCATGGATGGTAGCAGATGCTGATTCTAACAGCATGGGTACTGGCTATGGAGGATGGGATGATCTAGATACGCTAA
GGGAGATTAGAAATGACAATCCTTCAAACGAGAATGTTCGTCAAAAACAACAGTCTGTAAAAAGAGCTAGTCGGCGGTGG
AGAGTTAAGGAGAAGCCATTGCTCTTGAGGATGCTAATTGCTGCCTTCCCTTTTTTGGGTTCATGGACCAAATTGTTGTT
TTGA