Details for Lyrate rockcress Locus 16035590

Position : sca3 ( 5`- 9333218 .. 9330799 -3` )
Annotation : [B2G] fmn binding protein
External links : CoGe
PGDD synteny : 16035590

Protein [Map View]
MEALYTSTHIPNLQTKPLLKPSLPTSSQSSCWFCNSLPKKQFPKLRISNGSSHGLRIQALLHNETPSEGEDNNGFGFFPG
DIFSLSQEKLGSNSNGETSHSVIDVEASLAHPQGSGGNRAGLFRTPISGGVQNATSAHALPRPALAVRNLLEQARFAHLC
TVMSKMHHRREGYPFGSLVDFAPDRMGHPIFLFSPLAIHTRNLLAEPRCSLVVQIPGWSGLSNARVTLFGDVYPLSEDEQ
EWAHKQYIAKHPHRPSEQWGNFHYFRMQNISDIYFIGGFGTVAWVDVKEYEALQPDKIAVDGGERNLKELNAIFSKPLRE
LLSTESEVDDAALISIDSKGIDVRVRQGAQFNIQRLAFEEGHGVETLEEAKSALWKVMEKVKLNLQK*

DNA
ATGGAAGCTCTCTACACTTCAACACACATCCCCAATTTACAGACAAAGCCTCTCCTCAAACCTTCGCTGCCCACTTCATC
CCAGTCTTCCTGTTGGTTTTGTAATTCGCTACCCAAAAAGCAATTCCCGAAGCTGAGAATCAGTAATGGATCAAGTCACG
GGCTTCGTATACAAGCTCTCTTACATAACGAGACACCAAGTGAAGGCGAAGATAATAATGGGTTCGGTTTTTTTCCTGGG
GATATCTTCTCTTTATCACAGGAAAAGCTCGGGAGTAATAGCAATGGTGAAACTTCTCATAGTGTAATCGATGTGGAGGC
ATCTCTTGCACATCCTCAGGGGAGTGGAGGAAATCGAGCTGGACTTTTTAGAACTCCAATATCTGGTGGTGTTCAAAATG
CTACATCAGCTCATGCTTTACCTCGGCCTGCTTTAGCTGTACGGAACTTGTTGGAACAGGCTAGGTTTGCTCATCTATGC
ACAGTGATGTCCAAAATGCACCACCGCAGGGAAGGATACCCATTTGGCTCATTGGTAGATTTTGCACCTGATCGGATGGG
ACATCCAATATTTTTATTTTCACCGTTGGCCATCCACACACGAAATCTCTTGGCTGAACCGAGATGCAGTCTCGTTGTCC
AGATACCTGGATGGAGTGGCTTATCTAATGCTAGAGTGACATTATTTGGTGATGTATACCCATTGTCAGAAGATGAACAG
GAGTGGGCTCATAAGCAATATATTGCTAAGCACCCGCACAGGCCTTCTGAGCAATGGGGAAACTTTCACTATTTTAGGAT
GCAGAACATAAGTGATATATATTTCATTGGAGGCTTTGGCACGGTCGCTTGGGTTGATGTCAAAGAGTATGAAGCTTTAC
AACCAGATAAGATAGCTGTTGATGGTGGTGAGCGGAACCTCAAGGAACTAAATGCCATCTTCTCGAAACCGCTGAGAGAG
CTACTGTCTACTGAATCAGAGGTAGACGATGCTGCTCTAATTTCTATAGATAGCAAAGGAATAGATGTACGGGTTCGTCA
AGGTGCTCAGTTTAACATACAAAGGCTAGCATTTGAGGAAGGTCATGGTGTTGAGACACTAGAAGAAGCTAAATCTGCAC
TATGGAAAGTGATGGAGAAGGTCAAGCTGAATTTGCAGAAATGA