Details for Lyrate rockcress Locus 16035588

Position : sca5 ( 5`- 17941242 .. 17943183 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16035588

Protein [Map View]
MDPRRNFQPGGYDSRNTFTSGSFGPPDFGESDEAELVSVSWNQDYSCFAAGTSHGFRIYNCEPFKETFRRELKGGGFKIV
EMLFRSNILALVGGGPNSQYPSNKVLIWDDHQSRCISEFTFRSEIRAVKLRRDRIVVVLEHKIYVYNFMDLRLLHQIENL
ANPRGLCCLSHHMNTSVLACPGIRRGEVRVEHFGLNMVQIINAHDSNLACMTMTLDGLLLATASTKGTLIRIFNTMDGTR
LQEVRRGVDRADIYSIALSPNMQWLAVSSDKGTVHIFSLRVRVIGEDAYSTEHETSSNSMQPLVSPASGANPGSSLSFLR
GVLPKYFSSEWSFAQFHVPEVTQYFAAFGAQNTIAIIGMDGSFYRCNFDPVNGGEMTQLEHFHFLKPDSPR*

DNA
ATGGACCCTCGAAGAAACTTCCAACCAGGTGGTTATGACTCCCGGAATACCTTCACTTCAGGATCTTTTGGGCCTCCAGA
TTTTGGTGAAAGTGATGAAGCAGAGTTGGTTTCTGTTTCTTGGAATCAGGATTACAGCTGTTTTGCTGCTGGCACCAGCC
ATGGTTTTCGTATATACAACTGTGAACCGTTCAAGGAAACTTTCAGGCGAGAGCTGAAGGGTGGAGGGTTTAAAATTGTA
GAGATGCTTTTCCGGAGTAATATCTTGGCGCTTGTTGGTGGTGGACCTAACTCTCAGTACCCTTCAAATAAAGTATTGAT
TTGGGATGATCATCAGAGCCGCTGCATCAGTGAGTTTACTTTTCGGTCGGAAATTCGTGCAGTGAAGTTAAGAAGAGATC
GAATTGTAGTTGTTCTCGAGCACAAGATATATGTCTACAATTTTATGGATCTAAGACTTCTTCACCAGATTGAAAATCTG
GCAAATCCAAGGGGACTATGTTGCCTCTCTCATCATATGAATACATCTGTCCTGGCCTGTCCAGGTATTCGTCGAGGAGA
GGTCCGAGTTGAACATTTTGGGCTTAACATGGTTCAAATCATTAATGCTCATGATTCTAATCTCGCGTGTATGACCATGA
CATTGGATGGCTTGCTCCTTGCAACTGCCAGTACAAAGGGAACTCTGATTCGAATTTTCAACACTATGGACGGAACTCGT
CTGCAAGAGGTCCGAAGAGGCGTGGACAGAGCAGATATCTACAGCATTGCTCTATCACCAAACATGCAGTGGCTTGCAGT
ATCAAGTGACAAGGGGACTGTTCACATTTTCTCTCTTAGAGTGAGGGTTATTGGGGAGGACGCATACTCCACTGAACATG
AGACTTCTTCAAATTCTATGCAGCCTCTTGTTTCTCCAGCCAGTGGTGCCAACCCCGGTTCGTCATTGTCTTTTCTGAGA
GGAGTTCTACCAAAATATTTCAGCTCGGAATGGTCATTTGCTCAGTTCCATGTACCAGAAGTCACCCAATACTTTGCAGC
ATTTGGCGCTCAGAACACAATTGCGATTATTGGCATGGACGGAAGTTTCTACAGGTGCAATTTCGATCCAGTGAACGGAG
GAGAGATGACTCAGCTTGAACATTTCCATTTTCTGAAGCCAGATAGCCCGAGATAG