Details for Lyrate rockcress Locus 16035560

Position : sca1 ( 5`- 7711265 .. 7709052 -3` )
Annotation : [B2G] alpha beta fold family protein
External links : CoGe
PGDD synteny : 16035560

Protein [Map View]
MICSSKGTVVFATGNSFPRLPIKKSSSGFYVNRIQIRNDLPISIVATRRSSMSVEALPTRLKSSLKKTRKRNIGCGVSPS
SPTTTVVDDEVAVRRNLAMRRVLEDNGGDGSSVRDFSLFTTKRGDTLFTQSWTPVDSAKNRGLVVLLHGLNEHSGRYSDF
AKQLNVNGFKVYGIDWIGHGGSDGLHAYVASLDYAVADLKTFLEKVIAENPGLPCFCIGHSTGGAIILKAMLDAKIEARV
SGIVLTSPAVGVQPTYPIFGVIAPVLSFLIPRYQLSAAKKKIMPVSRDPEALLAKYSDPLVYTGFIRARTGHEILRLGAH
LLQNLSRIKVPFLVMHGTADTVTDPKGTQKLYNEASSSDKSIKLYDGLLHDLLFEPERETIAGVILDWLNRRV*

DNA
ATGATCTGTTCAAGTAAAGGAACGGTCGTATTTGCTACTGGAAACTCATTTCCCAGATTACCCATCAAAAAATCTTCTTC
CGGGTTTTATGTAAACCGGATTCAAATTCGAAATGATCTTCCGATTAGTATCGTTGCTACTCGACGATCATCAATGTCGG
TGGAGGCGTTGCCAACGAGATTAAAATCTTCACTGAAGAAGACGAGGAAGAGGAACATCGGCTGCGGTGTTTCCCCTTCT
TCGCCGACAACAACGGTGGTTGATGATGAAGTGGCGGTTAGACGGAATTTGGCAATGAGGCGGGTTTTGGAGGATAACGG
TGGCGATGGAAGCTCCGTCAGAGATTTCTCGCTATTCACGACCAAGAGGGGTGACACGTTGTTCACTCAGTCATGGACAC
CTGTTGACTCCGCTAAGAACAGGGGACTTGTTGTTCTGCTACATGGTCTGAACGAACACAGTGGCAGGTATAGTGATTTT
GCAAAGCAGCTAAATGTTAATGGATTCAAGGTCTATGGAATAGATTGGATCGGTCATGGTGGAAGCGATGGACTTCATGC
TTACGTTGCTTCTCTTGATTATGCTGTCGCTGATTTGAAAACGTTTCTTGAGAAGGTAATTGCGGAAAACCCGGGATTGC
CCTGTTTCTGCATTGGCCACTCAACTGGAGGAGCCATAATCTTAAAGGCCATGCTAGATGCAAAGATTGAAGCTCGAGTT
TCAGGGATTGTGCTAACTTCACCCGCAGTTGGAGTCCAACCAACTTATCCTATCTTCGGCGTAATTGCACCAGTTCTCTC
GTTCCTCATACCGAGATATCAGTTAAGTGCTGCAAAAAAGAAAATAATGCCGGTTTCTCGTGACCCGGAAGCTCTATTGG
CTAAATACTCTGACCCGCTAGTCTACACTGGATTTATCCGAGCAAGAACCGGTCACGAGATCCTTAGACTTGGTGCTCAT
TTACTGCAGAATCTGAGCAGAATCAAGGTTCCGTTTCTTGTGATGCACGGCACAGCTGATACAGTTACTGATCCTAAAGG
TACCCAAAAGCTATACAACGAGGCTTCCTCGTCCGATAAGTCGATCAAGCTTTACGATGGGTTGTTACACGATCTGCTCT
TTGAACCAGAACGGGAAACTATCGCTGGAGTCATATTGGATTGGCTAAACCGGCGGGTTTAA