Details for Lyrate rockcress Locus 16035548

Position : sca3 ( 5`- 1423235 .. 1416684 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16035548

Protein [Map View]
MISSKNGAAMISRPVFLSDRVDEVFSRKLDLSVSSSSSSSLLQQFNKTHEGDDDARLALAHQLYKGGDFKQALEHSNMVY
QRNPLRTDNLLLIGAIYYQLQEYDMCIARNEEALRIQPQFAECYGNMANAWKEKGDTDRAIRYYLIAIELRPNFADAWSN
LASAYMRKGRFSEATQCCQQALSLNPLLVDAHSNLGNLMKAQGLIHEAYSCYLEAVRIQPTFAIAWSNLAGLFMESGDLN
RALQYYKEAVKLKPAFPDAYLNLGNVYKALGRPTEAIMCYQHALQMRPNCAMAFGNIASIYYEQGQLDLAIRHYKQAISR
DPRFLEAYNNLGNALKDIGRVDEAIRCYNQCLALQPNHPQAMANLGNIYMEWNMMGPASSLFKATLAVTTGLSAPFNNLA
IIYKQQGNYSDAISCYNEVLRIDPLAADALVNRGNTYKEIGRVTEAIQDYMHAINFRPTMAEAHANLASAYKDSGHVEAA
ITSYKQALLLRPDFPEATCNLLHTLQCVCCWEDRSKMFAEVESIIRRQINMSVLPSVQPFHAIAYPIDPILALEISRKYA
AHCSIIASRFGLPPFTHPAGLPVKREGGFKRLRIGYVSSDFGNHPLSHLMGSVFGMHNRENVEVFCYALSANDNTEWRQR
IQSEAEHFLDVSSMSSDAIAKIINEDKIQILINLNGYTKGARNEIFAMQPAPIQVSYMGFPGTTGATYIDYLVTDEFVSP
LQYAHIYSEKLVHLPHCYFVNDYKQKNQDVLDPNSKPKRSDYGLPEDKFIFACFNQLYKMDPEIVNTWCNILKRVPNSAL
WLLRFPAAGEMRFRTYAAAQGVQSDQIIFTDVAMKSEHIRRSVLADVILDTPLCNGHTTGTDVLWAGVPMITLPLEKMAT
RVAGSLCLATGLGHEMIVNSLEEYEEKAVSLALNKPKLQALTKELRASRLTCPLFDTMRWVKNLERSYFKMWNLHCSGQQ
PQHFKVLENDLEFPHDR*

DNA
ATGATCTCGTCGAAAAACGGAGCTGCGATGATCTCTCGACCTGTGTTTCTTTCGGATCGAGTTGATGAAGTCTTCTCTAG
AAAGCTTGATTTGTCTGTTTCTTCTTCGTCTTCTTCGAGTCTCCTCCAGCAGTTCAATAAAACTCATGAAGGGGATGATG
ACGCACGCCTGGCTCTTGCTCATCAGCTGTACAAAGGAGGAGATTTCAAACAAGCCCTAGAGCACAGCAACATGGTTTAC
CAGAGAAACCCATTACGTACTGATAATCTTCTTCTGATTGGTGCTATTTATTACCAGCTCCAAGAGTATGATATGTGCAT
AGCTAGAAATGAAGAAGCTCTTCGTATTCAACCTCAGTTTGCTGAGTGTTATGGAAACATGGCAAACGCGTGGAAGGAAA
AAGGGGACACTGATCGTGCAATCCGCTACTATTTAATTGCAATTGAGCTGAGGCCCAACTTTGCTGATGCTTGGTCGAAC
TTGGCAAGTGCATACATGCGAAAGGGAAGATTCAGTGAGGCAACACAATGTTGTCAGCAGGCCCTCTCATTGAATCCACT
TCTGGTTGACGCACATAGTAATCTGGGGAATCTGATGAAGGCTCAAGGATTGATTCATGAAGCATACAGTTGTTACCTTG
AAGCTGTTCGTATACAACCAACATTTGCTATTGCATGGTCGAATCTTGCTGGTCTTTTCATGGAGTCAGGTGATCTCAAC
AGAGCCCTTCAATACTACAAGGAAGCTGTGAAGTTAAAACCTGCATTCCCTGATGCATATTTAAATTTAGGAAACGTGTA
TAAGGCTCTTGGAAGACCTACAGAAGCGATCATGTGTTATCAGCATGCCTTACAGATGCGGCCAAATTGTGCAATGGCAT
TTGGGAATATAGCCAGTATATACTATGAGCAAGGTCAACTGGATTTAGCAATTCGACACTACAAGCAGGCTATCTCCCGG
GATCCACGATTTTTGGAGGCTTACAATAACTTGGGTAATGCATTGAAGGATATTGGGCGAGTTGATGAAGCAATTCGGTG
TTATAATCAATGTCTTGCTTTACAACCAAATCATCCACAAGCAATGGCTAATCTTGGAAATATTTATATGGAGTGGAATA
TGATGGGTCCTGCTTCCTCATTATTCAAGGCTACTCTGGCTGTAACTACAGGGCTATCTGCTCCGTTCAATAACCTTGCT
ATAATTTATAAGCAACAGGGAAATTACTCGGATGCTATATCCTGCTATAATGAGGTTCTTCGTATTGACCCATTGGCAGC
TGACGCTCTGGTTAATAGAGGGAATACTTACAAAGAGATCGGGAGGGTAACTGAAGCTATTCAGGATTACATGCATGCTA
TTAATTTCCGACCTACAATGGCTGAAGCTCACGCAAACCTGGCCTCAGCTTACAAGGATAGTGGGCATGTGGAAGCTGCC
ATTACGAGCTATAAGCAGGCCTTGCTACTACGACCAGACTTCCCAGAAGCAACGTGCAACCTTCTGCACACCTTACAGTG
TGTATGCTGTTGGGAAGACCGTAGCAAAATGTTCGCTGAAGTTGAAAGCATTATTAGGAGGCAAATAAATATGTCGGTCC
TTCCAAGTGTCCAGCCCTTCCATGCAATAGCATATCCTATTGACCCTATTCTTGCCCTTGAAATCAGTCGTAAATATGCT
GCACACTGCTCCATAATCGCTTCTCGTTTTGGACTACCTCCTTTTACCCATCCAGCTGGGCTCCCTGTAAAACGTGAGGG
AGGATTTAAGAGATTAAGGATTGGATATGTGAGCAGTGATTTTGGTAACCATCCGTTGTCACACCTCATGGGATCAGTGT
TTGGGATGCACAACAGAGAAAACGTTGAGGTTTTCTGCTATGCATTGAGTGCAAATGATAATACTGAGTGGAGACAGCGT
ATCCAATCAGAAGCTGAGCATTTCCTGGACGTTTCTTCTATGTCATCTGATGCTATCGCCAAAATTATAAATGAAGACAA
AATCCAGATCCTCATCAATCTAAACGGTTATACCAAGGGGGCTAGAAATGAAATATTTGCCATGCAGCCTGCACCGATCC
AGGTTTCATATATGGGCTTCCCGGGTACAACTGGGGCAACCTATATTGACTATCTAGTGACTGATGAGTTCGTGTCTCCT
CTGCAATATGCACATATTTATTCAGAGAAGCTGGTCCATCTTCCCCATTGCTACTTTGTCAATGATTACAAGCAGAAAAA
TCAGGATGTGTTAGATCCAAATTCTAAGCCCAAGAGATCAGACTATGGACTTCCTGAAGACAAATTCATATTTGCATGCT
TCAACCAACTGTACAAAATGGATCCTGAGATCGTTAATACTTGGTGCAACATTCTTAAACGAGTACCCAACAGTGCTCTT
TGGCTTCTCCGTTTTCCAGCAGCCGGAGAGATGAGGTTTCGCACATATGCTGCTGCCCAAGGTGTACAGTCTGATCAAAT
TATCTTCACTGATGTTGCCATGAAGAGTGAACATATCAGGCGAAGTGTCCTTGCTGATGTAATCCTCGACACGCCTCTGT
GCAATGGACACACAACAGGAACAGATGTGCTGTGGGCTGGTGTACCGATGATAACATTACCACTTGAGAAAATGGCAACT
CGAGTGGCTGGATCACTCTGTCTTGCAACTGGTCTGGGCCATGAGATGATAGTTAACAGCTTGGAGGAGTACGAAGAGAA
GGCTGTCTCTTTGGCACTGAACAAGCCAAAACTTCAGGCACTGACTAAGGAATTGAGGGCTAGCCGCTTAACCTGTCCTC
TATTCGACACCATGCGTTGGGTGAAGAATCTGGAGAGGTCATACTTCAAAATGTGGAACCTCCATTGCTCTGGACAGCAG
CCACAACACTTCAAGGTGTTGGAAAACGACCTAGAATTCCCACATGACAGATAA