Details for Lyrate rockcress Locus 16035547

Position : sca3 ( 5`- 3816763 .. 3818610 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478284 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16035547

Protein [Map View]
MVNKSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHEANNGLDIAIR
LLEPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFSRMGLNDKDIVALS
GGHTLGRCHKERSGFEGAWTQNPLIFDNSYFKEILSGEKEGLLQLPSDKALLDDPLFRPFVERYAADEDAFFEDYKEAHL
KLSELGFADKE*

DNA
ATGGTGAATAAGAGTTACCCGGAAGTGAAAGAAGAGTACAAGAAAGCTGTTCAGAGATGCAAGAGGAAGCTCCGTGGTCT
TATCGCCGAGAAGCACTGTGCTCCTATCGTTCTCCGTCTTGCATGGCACTCGGCTGGGACATTTGACGTGAAGACGAAGA
CAGGAGGACCGTTTGGAACGATAAGGCATCCCCAAGAGCTAGCCCATGAGGCCAACAATGGTCTTGATATAGCAATTAGG
CTTCTTGAGCCGATCAAGGAGCTGTTCCCCATTCTGTCTTATGCTGATTTCTACCAGCTAGCTGGAGTTGTTGCTGTTGA
GATCACTGGAGGACCCGAGATTCCATTCCATCCTGGTAGACTGGACAAAGTTGAGCCACCTCCTGAAGGTCGTCTGCCTC
AGGCCACCAAAGGCGTGGATCATCTAAGAGATGTGTTTAGTCGGATGGGACTCAATGACAAAGATATTGTTGCATTGTCT
GGTGGACACACCTTGGGTCGGTGCCACAAGGAGCGCTCAGGATTCGAGGGAGCATGGACACAAAACCCGCTCATTTTCGA
CAACTCCTATTTCAAAGAGATACTAAGCGGAGAGAAAGAAGGACTTCTTCAATTACCAAGCGACAAGGCTCTTCTCGATG
ATCCTCTCTTTCGTCCCTTTGTTGAGAGATATGCGGCAGATGAGGATGCCTTCTTCGAAGACTATAAAGAAGCTCATCTG
AAGTTGTCAGAACTCGGGTTTGCTGACAAGGAGTAA