Details for Lyrate rockcress Locus 16035542

Position : sca1 ( 5`- 7661095 .. 7660337 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16035542

Protein [Map View]
MEIASFLKLLSETDGFGFGIFVFGCSSQFFNLVFLCCLLLLGLKFLFFKGTSLFLQYLEKIYRISSKIECFNAFDREHKD
CNNNGFISKSNLVDGLDQKKPIILHWSSDSTNGLSCDHIKNRDSTVALSETELDEKNYYGEEEESEDEEESRPRSDEDQV
FDVITLRKMVKRERKRGDCMKKELEKERRAAESAAEEAMAMLLKLRMEKSVVDMEAKQYKRVAEQKQVYDQQVIQSLQWM
LMKPDDEDKIQD*

DNA
ATGGAGATTGCTTCATTTCTGAAGCTTTTGAGTGAAACTGATGGTTTTGGATTTGGGATTTTCGTCTTTGGTTGCTCCTC
TCAGTTTTTCAATCTCGTCTTTCTCTGTTGTTTGCTTCTTTTGGGACTAAAGTTTCTATTTTTCAAAGGCACTTCATTGT
TTTTGCAGTATTTAGAGAAGATCTATCGAATTTCTTCGAAGATTGAGTGTTTCAATGCCTTCGATCGAGAACATAAGGAT
TGCAACAACAATGGGTTCATTTCAAAATCTAATTTGGTTGATGGATTGGATCAGAAGAAACCCATCATTTTACACTGGAG
TTCTGATTCTACTAATGGATTGAGCTGTGATCACATCAAGAACAGAGACAGTACTGTGGCATTATCGGAGACAGAGCTCG
ACGAGAAGAATTATTATGGCGAAGAAGAGGAAAGCGAGGACGAAGAAGAATCACGGCCTCGGAGTGATGAAGACCAAGTG
TTCGACGTAATTACTCTGAGAAAAATGGTGAAGAGAGAGAGGAAACGTGGAGATTGTATGAAGAAAGAGCTGGAGAAGGA
GAGAAGAGCAGCTGAATCAGCTGCTGAAGAAGCCATGGCTATGCTTCTGAAGCTACGGATGGAGAAAAGCGTTGTGGATA
TGGAGGCAAAGCAATACAAGAGAGTCGCGGAACAGAAGCAAGTGTATGATCAACAAGTGATTCAATCATTACAGTGGATG
TTAATGAAGCCTGATGACGAAGACAAGATTCAAGACTAA