Details for Lyrate rockcress Locus 16035524

Position : sca3 ( 5`- 12061133 .. 12063253 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_342637 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16035524

Protein [Map View]
MGMEALRFLHVIFFFVLILHCHYGTSLSGSSDVKLLLGKIKSSLQGNSESLLLSSWNSSVPVCQWRGVKWVFSNGSPLQC
SDLSSPQWTNNSLYNDSSLHLLSLQLPSANLTGSLPREIGEFSMLQSVFLNINSLSGSIPLELGYTSSLSDVDLSGNALA
GVLPPSIWNLCDKLVSFKIHGNNLSGVLPEPALPNSTCSNLQVLDLGGNKFSGEFPEFITRFKGLKSLDLSSNVFEGLVP
EGLGVLQLESLNLSHNNFSGMLPDFGESKFGAESFEGNSPSLCGLPLKPCLGSSRLSPGAVAGLVIGLMSGAVVVASLLI
GYLQNKKRKSSIESEDDLEEGDEEDEIGEKEGGEGKLIVFQGGENLTLDDVLNATGQVMEKTSYGTVYKAKLIDGGNIAL
RLLREGTCKDRSSCLPVIRQLGRIRHENLVPLRAFYQGKRGEKLLIYDYLPNISLHDLLHESKPGKPALNWARRHKIALG
IARGLAYLHTGQEVPIIHGNIRSKNVLVDDFFYARLTEFGLDKIMVQAVADEIVSQAKSDGYKAPELHKMKKCNPRSDVY
AFGILLLEILMGKKPGKSGRNGNEFVDLPSLVKAAVLEETTMEVFDLEAMKGIRSPMEEGLVHALKLAMGCCAPVTTVRP
TMEEVVKQLEENRPRNRSALYSPTETRSDAETPF*

DNA
ATGGGCATGGAAGCTTTGAGATTTCTTCATGTTATCTTCTTCTTTGTGTTGATTCTTCACTGTCATTATGGAACATCTCT
CTCTGGTTCTTCTGATGTGAAGCTTCTTTTAGGAAAGATCAAGTCTTCACTACAAGGAAACAGTGAGAGCTTACTTCTAT
CTTCTTGGAACTCTTCTGTTCCTGTTTGTCAATGGAGAGGGGTAAAATGGGTATTTTCAAATGGGTCTCCTCTTCAATGT
AGTGACCTCTCTTCACCACAATGGACTAACAACTCTCTGTACAACGACTCTTCTCTTCACCTTCTCTCTCTTCAGCTGCC
TTCTGCTAATCTCACTGGTTCACTACCTAGAGAGATTGGTGAGTTTTCTATGCTTCAAAGTGTGTTTCTCAACATCAATT
CTTTAAGTGGGTCAATCCCTCTTGAGCTTGGTTACACTTCCTCTCTCTCTGATGTTGATTTGAGTGGTAATGCCTTAGCT
GGGGTTTTACCTCCATCGATTTGGAACCTCTGTGATAAGCTTGTCTCTTTCAAGATTCATGGTAATAATTTGTCTGGGGT
TTTGCCTGAGCCTGCTTTACCAAATTCGACTTGTAGTAATCTCCAAGTTCTTGATTTGGGTGGTAATAAGTTCTCTGGTG
AGTTTCCTGAGTTTATAACTAGGTTTAAAGGTCTGAAATCACTTGATCTTTCAAGTAATGTCTTTGAAGGTCTTGTTCCT
GAGGGTTTAGGTGTATTACAGCTAGAAAGTCTCAATCTTTCTCATAATAACTTCAGTGGGATGTTGCCAGATTTTGGTGA
GTCAAAGTTTGGAGCAGAATCTTTTGAAGGGAACAGTCCTAGCCTTTGTGGTTTGCCTTTGAAGCCTTGTCTAGGCTCAT
CTAGGTTGAGTCCAGGTGCTGTTGCTGGTCTGGTGATTGGTTTAATGTCCGGGGCTGTTGTTGTGGCCTCGTTGTTAATA
GGGTATTTGCAGAACAAGAAAAGAAAGAGTAGTATAGAGAGTGAAGATGATTTGGAAGAAGGTGATGAAGAAGATGAAAT
CGGTGAAAAAGAAGGCGGTGAAGGGAAGTTAATTGTGTTCCAAGGTGGTGAGAATCTGACATTGGACGATGTTTTGAATG
CGACGGGGCAAGTTATGGAGAAGACTAGCTATGGTACTGTCTATAAGGCTAAGCTTATTGATGGTGGGAATATTGCATTG
AGGCTATTGAGAGAAGGTACTTGCAAGGACAGGAGTTCTTGTTTGCCTGTTATAAGGCAATTGGGACGCATTCGGCATGA
GAATTTGGTTCCCTTGAGAGCTTTCTATCAGGGGAAAAGAGGAGAAAAGCTTCTCATCTATGACTATCTTCCCAACATAA
GCTTACATGATTTGTTGCACGAAAGTAAACCTGGAAAGCCAGCTCTGAATTGGGCCAGGAGACACAAGATTGCACTTGGA
ATAGCGAGGGGACTTGCTTATCTTCATACTGGTCAAGAAGTTCCCATCATCCATGGCAATATTAGATCAAAGAACGTGCT
TGTGGACGACTTTTTCTATGCAAGGCTTACTGAGTTTGGGCTTGACAAGATAATGGTACAGGCAGTAGCAGATGAGATTG
TCTCGCAGGCGAAATCCGACGGGTACAAAGCACCTGAACTCCACAAGATGAAGAAATGCAATCCAAGGAGTGATGTTTAC
GCCTTTGGGATCCTTCTCTTGGAGATATTGATGGGTAAGAAACCGGGAAAGAGTGGAAGGAACGGTAATGAGTTTGTTGA
CTTGCCTTCTTTGGTTAAAGCTGCCGTGTTGGAAGAGACGACAATGGAGGTTTTCGACTTGGAGGCAATGAAAGGAATTA
GGAGTCCAATGGAAGAAGGTTTGGTTCATGCATTGAAGCTGGCAATGGGATGTTGTGCTCCTGTTACAACAGTTAGACCC
ACCATGGAAGAGGTTGTGAAGCAGTTGGAGGAGAACAGACCGAGGAATAGATCTGCATTGTACAGTCCAACAGAAACCAG
GAGCGACGCCGAAACTCCATTTTGA