Details for Lyrate rockcress Locus 16035513

Position : sca3 ( 5`- 3734103 .. 3733663 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897097 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16035513

Protein [Map View]
MSCCGGNCGCGSGCKCGNGCGGCKMYPDLGFSGETTTAETFVLGVAPAMKNQYEASGESNNAENDACKCGSDCKCDPCTC
K*

DNA
ATGTCTTGCTGTGGAGGAAACTGCGGTTGTGGATCTGGCTGCAAGTGCGGCAACGGATGTGGAGGTTGCAAAATGTACCC
TGACTTGGGATTCTCCGGCGAGACAACCACAGCTGAGACTTTTGTCTTGGGCGTTGCACCGGCGATGAAGAATCAGTACG
AGGCTTCAGGCGAGAGTAACAACGCTGAGAACGATGCTTGCAAGTGTGGATCTGACTGCAAGTGTGACCCTTGCACCTGT
AAATGA