Details for Lyrate rockcress Locus 16035491

Position : sca3 ( 5`- 3425549 .. 3423216 -3` )
Annotation : [B2G] metal transporter family protein
External links : CoGe
PGDD synteny : 16035491

Protein [Map View]
MMHSSCKRLLLLLFLFVVVFIRNTDANSQWEISHKVRASPHENMGRNVIDGSGVEKTLHDIGMGEKRGTHNKVSVSTVAL
FTLAMAAATGLGALPFFFVELDPQWAGICNGMAAGVMLAASFDLVKEGQEHGSGNWVVTGILAGALFIWLCKQILEQYGE
VSMLDIKGADATKVVLVIGIMTLHSFGEGSGVGVSFAGSKGFSQGLLVTLAIAVHNIPEGLAVSMVLASRGVSPQNAMLW
SIITSLPQPLVAVPAFLCADAFSKFLPFCTGFAAGCMIWMVIAEVLPDAFKEASPSQVASAATISVASMEALSTLFESFT
HDYNSEDASGFFISLLFGLGPLLGGVFLVASAVTFRLQHALLMGVASGIAFVLGLWRPLQLLLSAKMGFIPLVSLLAVGA
GLSYFTSSTILNVTCRKKSRAGSLINPVTNFPTSVITLQSLLACGAVGFHALAEGLALGVAAPNAYGLGRHMVLPVSLHG
LPRGTAVASCVFGATDSWHAALAAAALIGFVGPISAIGSILAGIDYSGLDHVMVVACGGLLPSFWQVIKRAVRLERRKGS
VGMVLGLVCAVVCLTFTRLVCLHTPYCNSAPEAVR*

DNA
ATGATGCATTCAAGCTGCAAACGACTTCTGCTGCTTCTATTCTTATTTGTCGTTGTATTCATTCGGAACACTGATGCAAA
TTCTCAGTGGGAGATTTCACATAAAGTTAGAGCTTCTCCCCATGAAAACATGGGACGAAATGTTATTGACGGAAGTGGTG
TAGAAAAAACCTTACATGACATTGGAATGGGTGAAAAGAGAGGCACTCACAACAAAGTTTCAGTTTCAACAGTTGCATTG
TTCACCTTGGCTATGGCTGCTGCCACTGGGTTAGGTGCTCTGCCCTTCTTCTTTGTTGAGCTTGATCCTCAGTGGGCTGG
AATCTGCAATGGTATGGCGGCTGGTGTGATGTTGGCCGCTAGCTTTGATCTTGTTAAGGAAGGGCAGGAGCATGGCTCTG
GAAACTGGGTTGTTACTGGGATCCTAGCCGGTGCTTTGTTCATCTGGCTCTGTAAGCAGATTCTTGAACAATATGGTGAA
GTTAGTATGCTGGATATTAAAGGTGCAGATGCAACTAAAGTTGTTCTCGTCATAGGAATTATGACACTTCATTCTTTCGG
GGAAGGATCAGGGGTTGGTGTATCGTTCGCTGGTTCAAAGGGTTTTAGTCAAGGGCTTCTGGTCACTTTGGCTATAGCTG
TTCATAACATTCCAGAAGGGTTGGCTGTTAGCATGGTGCTGGCATCAAGGGGTGTCTCTCCACAAAATGCCATGCTCTGG
AGTATAATAACATCCTTACCTCAGCCTCTCGTCGCTGTGCCAGCTTTTTTATGCGCTGATGCGTTCAGCAAGTTTTTGCC
TTTTTGCACTGGATTCGCTGCCGGATGCATGATTTGGATGGTTATTGCTGAAGTGCTTCCTGATGCATTTAAGGAAGCGT
CTCCGTCGCAAGTGGCATCTGCAGCCACAATATCAGTAGCATCCATGGAAGCTCTTAGCACTCTTTTCGAGAGTTTCACA
CATGATTACAACTCAGAGGATGCTTCTGGCTTCTTCATTTCACTCCTCTTTGGTCTGGGTCCATTGCTTGGGGGAGTATT
TCTGGTTGCATCGGCAGTGACCTTCCGTCTCCAGCACGCCCTTCTCATGGGAGTAGCCTCAGGCATTGCTTTTGTCCTTG
GTCTCTGGCGCCCGCTTCAACTGCTGCTATCCGCAAAAATGGGGTTTATCCCTCTGGTTAGTCTACTTGCAGTTGGAGCC
GGGCTGAGCTATTTCACTAGCTCGACAATCCTGAATGTAACCTGTCGGAAAAAGTCCCGGGCTGGCAGTTTAATAAACCC
AGTAACCAATTTTCCAACCAGTGTGATAACACTCCAATCATTATTAGCGTGTGGAGCGGTTGGGTTCCATGCACTAGCGG
AGGGGCTTGCTCTTGGTGTGGCTGCTCCAAATGCTTATGGACTTGGCCGACACATGGTACTCCCGGTTTCCCTACACGGG
CTCCCAAGAGGGACAGCGGTTGCTAGCTGTGTCTTTGGGGCCACTGACAGTTGGCACGCAGCTCTTGCAGCAGCAGCTTT
GATAGGATTTGTGGGACCCATATCGGCGATAGGATCCATATTAGCCGGGATAGATTACAGCGGACTGGACCACGTGATGG
TTGTAGCGTGCGGTGGATTACTACCCAGCTTCTGGCAGGTAATTAAGAGAGCGGTGAGGTTAGAGAGAAGGAAAGGCAGT
GTGGGGATGGTGCTGGGACTAGTGTGTGCTGTTGTGTGTCTGACTTTCACAAGACTCGTGTGCTTGCACACACCCTACTG
CAATTCTGCACCTGAGGCTGTTAGATGA