Details for Lyrate rockcress Locus 16035462

Position : sca3 ( 5`- 12389359 .. 12390708 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_899104 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16035462

Protein [Map View]
MDYMRIFSVFVVTLWIIRVDARVLGGRGIEKFVTFGQNYVVKWGQSHVSTLHSGEEVDLYIDQSSGGGFESKDSYGSGLF
EMRIKVPGGNTGGIVTAFYLTSKGGGHDEIDFEFLGNNNGKPVTLQTNLFLNGEGNREERFLLWFNPTKHYHTYGLLWNP
YQIVFYVDNIPIRVYKNENGVSYPSRPMQVEASLWNGDDWATDGGRTKVNWSYSPFIAHFRDFALSGCNIDGRSNNVGAC
ESSNYWWNAGKYQRLSGNEQKLYEHVRSKYMNYDYCTDRSKYQTPPRECY*

DNA
ATGGACTATATGAGAATCTTTAGTGTTTTTGTAGTAACGTTATGGATCATAAGGGTTGATGCTAGGGTTTTGGGAGGACG
AGGAATCGAAAAATTTGTTACTTTCGGTCAGAATTATGTTGTTAAGTGGGGACAAAGTCATGTTTCTACACTCCACTCTG
GCGAAGAAGTTGATCTCTACATCGATCAATCTTCAGGTGGTGGCTTCGAATCCAAGGACAGCTACGGATCAGGTCTCTTT
GAAATGAGAATCAAAGTGCCTGGAGGAAATACTGGCGGCATCGTCACCGCGTTTTACTTGACGTCGAAAGGAGGTGGTCA
CGACGAGATTGACTTCGAGTTTCTAGGGAACAACAATGGAAAACCGGTAACGTTACAGACAAATCTGTTTCTGAATGGAG
AAGGAAACAGAGAAGAGAGGTTTTTGCTTTGGTTCAATCCAACCAAACACTACCACACTTATGGGCTTCTTTGGAACCCT
TACCAAATTGTGTTTTACGTGGACAACATCCCAATAAGAGTATACAAAAACGAAAACGGTGTAAGCTATCCATCAAGGCC
TATGCAAGTCGAGGCTAGTCTCTGGAACGGTGACGATTGGGCGACTGATGGTGGTCGGACTAAGGTTAACTGGTCATACT
CTCCTTTCATTGCCCATTTCCGAGACTTCGCCTTATCCGGTTGCAACATAGATGGTCGGAGTAATAATGTGGGCGCTTGT
GAATCCTCCAACTACTGGTGGAATGCAGGCAAGTATCAAAGATTAAGCGGAAACGAACAGAAACTTTATGAGCATGTGAG
GAGCAAGTACATGAACTATGACTATTGTACTGACCGGTCTAAGTACCAAACTCCTCCTAGAGAATGTTATTGA