Details for Lyrate rockcress Locus 16035433

Position : sca3 ( 5`- 2573466 .. 2571440 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477944 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16035433

Protein [Map View]
MERYGRAGEEGSRSDPSLEWTSHGGETGLEASMWRLGLSGGGGESYPERPDEPDCIYYLRTGVCGYGSRCRFNHPRDRGA
VIGGVRGEAGALPERMGHPVCQHFMRTGTCKFGASCKYHHPRQGGGGGSVAPVSLSYLGYPLRPGEKECSYYLRTGQCKF
GLTCRFNHPVPLAVQGPPQHQQQQQPQLQTIYPTLQSQSVPSSQQYGLVLTRPSLLPGSYLPSPYGPPMVLPPGMVPYSG
WNPYQASLSAMPSPGTQPSIGSSSVYGITPLSPSVTAYTGAYQSGPSSNTSKEFPQRPDQPECQYFMRTGDCKFGSSCRY
HHPVDAVPPKTGLVLSSIGLPLRPGVAQCTHFSQHGICKFGPACRFDHSMSSSLSYSPSASSLTDMPVAPYPIGSSSLSG
SSAPVSSSNEPTTEAVTAAAVSTSMVSGLSRPEPAETSGDSASVSGSIEAKTSS*

DNA
ATGGAGCGGTACGGTCGCGCCGGTGAAGAAGGGTCGCGATCGGATCCATCTCTTGAATGGACCTCTCATGGAGGTGAAAC
CGGACTCGAAGCTTCGATGTGGCGGTTAGGGTTGAGCGGCGGCGGAGGAGAATCCTACCCGGAGCGACCCGACGAGCCTG
ATTGTATTTATTACTTGAGAACCGGCGTTTGCGGGTACGGGTCAAGATGTCGGTTTAATCACCCACGAGATCGTGGAGCG
GTTATTGGAGGTGTGAGAGGAGAAGCTGGAGCTTTACCGGAGAGGATGGGACATCCGGTTTGTCAGCATTTTATGCGAAC
GGGAACGTGTAAATTCGGTGCTTCTTGCAAGTATCATCATCCTAGGCAAGGAGGTGGTGGTGGTTCCGTTGCACCCGTCT
CGCTTAGTTATTTGGGATATCCATTACGCCCGGGAGAGAAAGAGTGCTCTTATTACTTGAGAACCGGTCAGTGTAAATTT
GGTTTGACTTGTAGATTCAACCATCCCGTGCCACTCGCTGTACAGGGTCCACCTCAGCATCAGCAACAGCAACAGCCACA
GCTACAGACTATTTATCCGACACTTCAGTCTCAATCCGTTCCTTCCTCTCAACAATATGGGTTAGTTTTGACAAGGCCTT
CTCTTTTACCTGGTTCATATCTTCCAAGCCCTTACGGTCCTCCAATGGTTCTGCCTCCGGGAATGGTTCCATACTCTGGT
TGGAATCCTTACCAGGCTTCTTTAAGTGCAATGCCTTCGCCTGGAACTCAACCGTCTATTGGATCAAGCTCTGTTTATGG
AATCACGCCGTTATCTCCTTCAGTGACTGCATATACAGGAGCATATCAATCTGGCCCGTCTTCAAATACCTCAAAAGAGT
TTCCTCAGCGACCTGATCAACCCGAGTGTCAATACTTCATGAGAACCGGTGACTGTAAATTCGGATCCTCTTGCCGATAC
CATCATCCTGTAGATGCAGTTCCACCTAAGACTGGCCTTGTCCTGAGCTCCATTGGCCTTCCACTTCGTCCCGGAGTAGC
GCAATGCACTCACTTTTCTCAACACGGAATCTGCAAGTTTGGACCGGCGTGTAGGTTTGATCACTCAATGAGTTCTTCGC
TTAGCTATAGTCCGTCTGCATCATCACTAACCGATATGCCCGTGGCTCCATACCCAATCGGATCATCCTCACTCAGCGGC
TCATCAGCTCCAGTAAGCTCAAGCAATGAACCCACCACAGAGGCTGTGACTGCTGCTGCAGTTTCCACTTCTATGGTCAG
TGGCTTGAGCCGTCCAGAGCCAGCTGAGACGAGTGGTGACTCGGCCAGCGTCAGTGGCAGCATAGAAGCTAAGACTTCAA
GTTAA