Details for Lyrate rockcress Locus 16035430

Position : sca3 ( 5`- 5504397 .. 5505638 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897586 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16035430

Protein [Map View]
MMSCGVKKPVSKKTTPCCTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGG
ITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDPQTHKPLDANNVLKQEEEVSGGQNPIE
PISSSHTDDTTVNSGDGDSKNSINVFGGESGYEDFGFCYDDKFSSFLNSLINDDADPFGNIMPISQPLQMDDCKHEIVGA
SSSSLGHDLQRQEDI*

DNA
ATGATGTCATGTGGTGTGAAGAAACCTGTTTCGAAGAAAACAACGCCGTGTTGCACGAAGATGGGGATGAAGAGAGGACC
ATGGACGGTGGAGGAGGACGAGATTCTTGTGAGCTTCATAAAGAAAGAAGGTGAAGGACGGTGGCGATCGCTTCCTAAGA
GAGCTGGTTTACTCCGATGTGGAAAGAGCTGCCGTCTTCGGTGGATGAACTATCTCCGACCGTCGGTTAAACGCGGCGGA
ATTACGTCGGACGAGGAAGATCTCATCCTCCGCCTTCATCGCCTTCTAGGCAACCGGTGGTCACTGATCGCTGGAAGGAT
ACCGGGAAGGACTGATAACGAAATTAAGAACTATTGGAACACTCATCTTCGTAAGAAACTTCTAAGGCAAGGAATTGATC
CTCAAACCCACAAGCCTCTTGATGCAAACAACGTCCTCAAACAAGAAGAAGAAGTTTCCGGTGGACAAAACCCCATAGAG
CCTATTTCTAGTTCTCATACTGATGATACCACCGTTAATAGCGGGGATGGAGATAGCAAGAACAGTATTAATGTCTTTGG
TGGTGAAAGCGGCTACGAAGACTTTGGTTTCTGCTACGACGACAAGTTCTCATCGTTTCTTAATTCGCTTATCAACGATG
ATGCTGATCCTTTTGGTAACATTATGCCAATATCTCAACCGTTGCAGATGGATGATTGTAAGCATGAGATTGTTGGAGCG
TCGTCATCTAGCTTAGGACATGACCTGCAGAGACAAGAAGATATATAG