Details for Lyrate rockcress Locus 16035426

Position : sca3 ( 5`- 9084646 .. 9082120 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16035426

Protein [Map View]
MGDHHDFINSGSWWKVSSSSSPSSSSSMRASSIESGGSAVFHDHKLHHHHDHSLATTDHHLQMIGLGLSSQSPVDQWNQS
LLRGDSKAETSFGVMLQENLNLDASSNANANTTSSTSSYQLQESDSSHQHQALWRDPQSDFKPQILTSGGNRGFFLDHQF
SPHGSSSTDSSTVTCQGFAVDNSSNTMYAATTTTPNSSSGMFHHQQAGGFGSSDQQQSRNQQQQSLAYSQFGSSTGNYDQ
MASALPSTWFLRSSPPKPHSPLRFSNNATFWNPAASGNAGPPPPHDASSNFFPALQPPQIHPPSFDEQPKNITEIRDSSS
SEVKRGGGHQQPAAKRAKSEAASPSPAFKTDAASVLSEAIEYIKFLHQQVSALSNPYMKSGASLQHQQSDHPTELEVSEE
ADLRSRGLCLVPVSSTFPVTHDTTVDFWTPTFGGTFR*

DNA
ATGGGAGATCATCATGATTTCATCAACTCAGGAAGCTGGTGGAAAGTATCTTCTTCTTCTTCACCATCTTCTTCATCTTC
CATGAGAGCAAGCTCTATTGAATCTGGTGGTTCTGCTGTTTTCCATGATCATAAGCTTCATCATCATCATGATCATTCTT
TAGCTACTACTGATCATCATCTTCAGATGATTGGTTTAGGGCTTTCTTCACAATCACCTGTTGATCAATGGAACCAATCT
CTCTTACGAGGGGATAGTAAAGCGGAGACAAGCTTTGGTGTGATGCTTCAAGAGAATCTCAATTTAGATGCGAGTTCAAA
CGCAAACGCTAACACAACGTCATCCACATCTTCTTACCAGCTGCAAGAATCTGATTCCTCTCACCAGCACCAAGCTTTGT
GGCGAGATCCACAAAGCGATTTCAAACCGCAGATTTTAACGAGTGGTGGTAATCGCGGGTTTTTCTTAGATCATCAATTC
AGCCCTCATGGGAGCTCAAGTACCGACAGTAGCACAGTGACATGTCAAGGTTTCGCTGTTGACAACTCTTCCAACACCAT
GTACGCAGCAACAACGACAACTCCTAATTCATCTTCCGGTATGTTTCATCATCAACAAGCAGGTGGTTTTGGCTCTTCCG
ATCAACAACAGTCGAGGAATCAGCAGCAGCAATCTCTCGCCTATTCTCAGTTTGGATCATCCACCGGAAACTATGATCAA
ATGGCGTCAGCGTTACCATCGACTTGGTTTTTAAGATCTTCTCCACCAAAACCACACAGTCCTTTGAGATTCTCTAACAA
CGCAACGTTTTGGAACCCTGCGGCTTCCGGAAACGCCGGTCCTCCTCCTCCTCATGACGCGTCTTCTAACTTTTTCCCGG
CGTTACAACCGCCGCAGATTCACCCGCCGAGTTTTGACGAACAACCAAAGAATATAACGGAGATTCGAGATTCGAGTAGC
AGCGAAGTAAAGAGAGGAGGAGGCCATCAGCAGCCGGCGGCGAAAAGAGCTAAGAGCGAAGCAGCGTCTCCGTCACCAGC
TTTCAAGACTGATGCAGCCTCAGTGCTCTCTGAAGCCATTGAATACATTAAGTTCTTACACCAACAAGTTTCAGCTCTGA
GCAACCCATACATGAAAAGTGGAGCCTCTTTACAACATCAACAGAGTGATCATCCCACAGAGCTAGAAGTATCAGAAGAA
GCAGATCTTAGAAGTCGAGGTTTATGCTTAGTGCCAGTTTCAAGCACATTTCCAGTGACACACGATACTACTGTAGATTT
CTGGACTCCTACATTTGGTGGGACTTTTAGATAG