Details for Lyrate rockcress Locus 16035405

Position : sca3 ( 5`- 3031415 .. 3030345 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16035405

Protein [Map View]
MIQLLFLVLFVEGAIAFLLLVKIGPLRELVMKSLDQLKLGKGPATVKTIAGTMSVILLSNLMNIIKIQNKGAKLGTMSPM
DQVLWRTHLLEASLMGVVLFFGFIIDRTHHYLEKLITLRSNVGSSKGELEQLRKERTELKEKEEKTSKEIKQLKEKLSCV
SENLKKAEKESKEKETKLETAEAHVTALQKQSSELLLEYDRLLEDNQNLQSQILVGTKKT*

DNA
ATGATTCAGTTACTATTCCTGGTTCTGTTCGTAGAAGGTGCGATTGCGTTCTTACTATTGGTGAAGATTGGTCCTTTAAG
GGAGCTTGTAATGAAGAGCTTAGACCAGCTTAAATTGGGGAAAGGTCCTGCTACTGTGAAAACCATCGCTGGAACCATGT
CTGTGATCCTCCTGTCGAATCTCATGAATATCATTAAGATCCAGAACAAGGGTGCCAAACTTGGGACAATGTCTCCTATG
GATCAAGTCCTCTGGAGAACACACTTGCTTGAGGCTTCTCTTATGGGTGTTGTGCTCTTTTTCGGCTTCATCATTGACCG
GACACATCATTACCTCGAAAAGCTTATCACTTTAAGAAGCAATGTCGGGTCATCGAAAGGAGAACTGGAACAACTTAGGA
AGGAGAGAACCGAACTGAAGGAGAAAGAAGAGAAGACATCCAAGGAAATTAAGCAGCTGAAAGAAAAACTGTCCTGTGTT
TCAGAGAATCTGAAGAAAGCAGAGAAGGAATCCAAAGAGAAAGAAACAAAGCTCGAAACAGCTGAAGCCCATGTCACAGC
TCTTCAAAAGCAGTCTTCAGAGCTATTGTTGGAGTATGACAGATTGCTAGAAGACAACCAGAATCTCCAAAGCCAGATTT
TGGTAGGAACAAAGAAAACCTGA