Details for Lyrate rockcress Locus 16035395

Position : sca3 ( 5`- 4669917 .. 4669189 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16035395

Protein [Map View]
MGTKQPYLNGAYYGPSIPPPAKAHRSYDSPGFGCCCFSCLGSCLRCCGCCILSLICNILIAIAVILAITGFILWLIFRPN
AVKFYVADANLNRFSFDSNNNSNLHYSLDLNFTIRNPNQRVGVYYDEISVSGYYGDQRFGSVNVSSFYQGHKNTTVVLTK
IEGQNLVVLGDGARTDLKEDEKSGVYRIDAKLRLSVRFKFWVIKSWKLKPKIKCDDLKIPLGSSNSTGGFKFQPVKCDFD
LS*

DNA
ATGGGGACCAAACAACCATACCTAAACGGCGCATACTACGGACCATCGATTCCTCCGCCGGCTAAAGCTCACCGCAGCTA
TGACTCACCTGGATTCGGATGCTGTTGCTTCAGCTGCCTCGGAAGCTGTCTACGCTGCTGCGGTTGCTGCATCTTAAGCC
TGATCTGCAACATCCTCATAGCCATAGCCGTAATCCTCGCAATCACCGGTTTTATCCTCTGGCTCATATTCCGTCCAAAC
GCCGTCAAATTCTACGTCGCCGACGCTAATCTGAACCGATTCAGCTTCGATTCAAACAACAACAGCAATCTCCATTACAG
TCTCGATCTCAATTTCACAATCCGTAACCCTAATCAACGAGTCGGAGTCTACTACGATGAGATCTCGGTGAGTGGCTATT
ACGGTGATCAGAGATTCGGATCTGTGAACGTATCGTCGTTTTATCAAGGGCATAAGAATACGACGGTGGTTTTAACAAAA
ATTGAAGGACAGAATCTGGTGGTGCTCGGCGACGGAGCGAGAACAGATCTGAAGGAAGATGAGAAATCTGGGGTTTATCG
GATTGATGCGAAATTGCGGCTAAGTGTTCGGTTTAAGTTTTGGGTGATTAAGTCGTGGAAGCTTAAACCAAAGATTAAGT
GTGATGATCTTAAGATTCCTCTTGGTTCCTCTAATTCAACCGGAGGGTTTAAGTTTCAACCAGTCAAGTGTGATTTTGAC
TTATCTTAG