Details for Lyrate rockcress Locus 16035374

Position : sca3 ( 5`- 5711923 .. 5706524 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478791 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16035374

Protein [Map View]
MDAACSTQLIDGDGVFNVAGVDHFIKEVKLEECGLSYAVVSIMGPQSSGKSTLLNHLFGTNFREMDAFRGRSQTTKGIWI
ARCAGIEPCTVVMDLEGTDGRERGEDDTAFEKQSALFALAVSDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRK
TTLMFVIRDKTRTPLENLEPVLREDIQKIWDSVPKPQAHKETPLSDFFNVEVVALSSYEEKEEQFKEQVYNLRQRFFQSV
APGGLAGDRRGVVPANAFAFSAKQMWQVIKDNKDLDLPAHKVMVATVRCEEIANEKFSSFIANENWRELEEAVQSGPVSG
FGRKLSSILQSSLSEYDTEATYFEESVRSSKRQQLQEKLLQLVQPTFQDVLGHLRSGALENFKNAFEKALNAGEGFSSSA
KSCAQSCISKFDKGCEEAVIEQANWDTSKTREKLERDIEAHISSVRTAKLAELTTLYESKLNVALSGPVEALLDGANDET
WPAIRKLLRREGELAVYGLSDALSGFEMDKETRSKMLADLENYARGIVETKAKEEAGRALMRMKDRFATIFSHDSDSMPR
VWTGKEDIRAITKMARSASLKLLSVMAIIRLDDELDNIEKTLTLSLFNSTGNNATSKSISTIDSLASSTWEQVAPEKTLI
TPVQCKSLWRQFKNETEYTVTQAISAQEANRRNNNWLPPPWAILALVVLGFNEFMTLLRNPLWLLVLFVGYLISKALWVQ
LNISGEFRNGALPGLLSLSTKFIPTVMNLLKKLAEEGQAPPTNSNQSMNSTAQSEVTTNGESSSSSSSSGSPPAKNVPID
TSA*

DNA
ATGGATGCCGCTTGCTCTACCCAGCTTATCGATGGAGATGGTGTCTTTAATGTTGCTGGGGTTGATCATTTCATCAAGGA
GGTTAAATTGGAAGAATGTGGTCTTTCATACGCGGTTGTCTCGATTATGGGTCCACAAAGTAGTGGGAAGAGCACGCTCT
TGAATCATTTGTTTGGAACCAACTTTAGAGAAATGGATGCATTTAGAGGAAGGTCTCAGACGACTAAGGGAATTTGGATT
GCTAGATGTGCTGGTATTGAGCCTTGCACCGTTGTGATGGATTTAGAGGGTACCGATGGGAGAGAGCGCGGTGAGGATGA
TACTGCTTTCGAGAAACAGAGTGCTCTTTTTGCACTTGCTGTCTCAGACATAGTTCTTATAAACATGTGGTGTCATGACA
TTGGTCGGGAACAAGCAGCAAATAAACCTCTTTTAAAGACTGTGTTCCAGGTTATGATGCGGTTGTTTAGTCCGCGGAAG
ACAACTTTGATGTTTGTTATAAGAGATAAGACACGGACGCCACTGGAAAATTTAGAACCAGTGCTGAGGGAAGACATTCA
AAAGATATGGGATTCAGTCCCCAAGCCTCAGGCACACAAAGAAACTCCACTTAGTGATTTCTTCAATGTTGAAGTAGTTG
CTCTCTCGAGTTATGAAGAAAAGGAAGAGCAATTCAAAGAGCAGGTCTACAATTTGAGACAACGGTTCTTCCAATCTGTC
GCACCTGGCGGGCTTGCTGGTGATCGACGAGGAGTTGTCCCTGCCAATGCTTTTGCTTTTAGTGCAAAACAGATGTGGCA
AGTCATTAAAGACAACAAAGACTTGGATCTTCCAGCACACAAGGTCATGGTAGCAACTGTGCGATGCGAGGAAATTGCCA
ATGAAAAATTCTCTAGTTTTATCGCGAATGAGAATTGGCGCGAGTTGGAAGAGGCTGTACAGTCTGGTCCTGTTTCCGGA
TTCGGAAGAAAGCTGAGCTCCATTCTCCAATCTAGCTTATCAGAGTATGACACAGAAGCGACCTACTTTGAAGAAAGTGT
AAGATCATCCAAGAGACAACAGCTGCAAGAAAAGTTATTGCAACTTGTTCAACCAACTTTCCAAGACGTGCTTGGACATT
TGAGATCTGGAGCACTTGAAAACTTCAAGAATGCTTTTGAGAAGGCCTTGAATGCTGGAGAAGGGTTTTCATCATCTGCG
AAATCCTGCGCTCAGTCATGCATATCTAAGTTTGATAAAGGATGTGAAGAGGCTGTTATTGAACAAGCAAATTGGGATAC
ATCTAAAACTCGGGAAAAGCTTGAGCGTGATATTGAAGCCCATATCTCTTCTGTCCGTACTGCAAAGTTGGCTGAACTGA
CTACTCTGTATGAGTCAAAACTAAATGTAGCATTATCCGGACCGGTGGAAGCTCTTCTGGATGGGGCTAATGATGAAACA
TGGCCAGCAATTAGAAAGCTACTTAGACGGGAAGGAGAATTGGCTGTCTATGGTCTCTCTGACGCATTATCTGGTTTCGA
AATGGACAAAGAAACACGGAGTAAAATGCTTGCTGATCTCGAAAACTATGCACGAGGTATTGTTGAAACCAAGGCAAAAG
AAGAGGCTGGAAGAGCGTTGATGCGCATGAAGGATAGATTTGCTACAATCTTCAGCCATGATTCTGATTCAATGCCACGT
GTTTGGACTGGAAAGGAGGACATCAGAGCAATCACAAAAATGGCTCGTTCTGCATCCTTGAAGCTGCTGTCTGTTATGGC
TATTATACGCTTGGATGATGAACTCGACAATATTGAGAAAACATTGACGCTCTCTCTGTTTAATTCTACGGGCAACAATG
CTACTAGCAAGAGCATCAGCACAATTGATTCACTTGCCTCAAGCACTTGGGAGCAGGTTGCACCAGAAAAGACGTTGATC
ACGCCTGTGCAGTGTAAATCACTGTGGAGGCAATTCAAGAATGAGACAGAATATACCGTTACACAGGCCATTTCTGCACA
GGAAGCTAACCGACGGAATAACAACTGGCTGCCACCTCCATGGGCAATCCTTGCCCTGGTTGTTCTTGGATTCAATGAAT
TTATGACTCTCTTAAGAAATCCTCTATGGCTCTTAGTTCTTTTTGTCGGATACCTTATTTCCAAAGCCTTGTGGGTGCAA
TTAAATATTTCAGGAGAATTCCGCAATGGCGCGCTACCTGGACTTCTCTCCTTGTCAACCAAATTCATTCCAACGGTCAT
GAACCTCCTCAAAAAGCTCGCGGAAGAAGGACAAGCACCACCCACAAATAGCAACCAATCAATGAACTCTACAGCTCAAT
CCGAGGTTACAACCAATGGAGAAAGCAGCAGCAGCAGCAGTAGCTCTGGTTCACCTCCAGCAAAAAACGTACCCATTGAT
ACAAGTGCATAG