Details for Lyrate rockcress Locus 16035360

Position : sca3 ( 5`- 3098872 .. 3096786 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16035360

Protein [Map View]
MENELFMNAGASSHTPVMTSPSSSPAMLNWVSMETQPVDPSLGCNLFWEKSTEQSIFHSALSSLVSSPTPSNSNFSGGEN
VVIRELIGRLSNIGDIYGTPASNGNVSGSCYATPMSSPTPGRMMVTKTTMPITEFSGDPGFAERAARFSCFGSRSFNGRT
NSPFPINNEQPVATNEKMPRISSSPVLKPLVSHVPAGESSGEYSRKRKAKSKQNSPSTVSPSKEIEEKEDSDPKRCKKSE
DNGDKTKSIDPYKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYVQSLQRQVEF
LSMKLSSVNTRLDFNMDALLSKDIFPSSNNLMHHQHVLQLDSSAETLLGDHHNNNLRLNPDISCNNIINPSETSETRSFI
SHLPTLAHFTDSISQYSTFSEDDLTSIIQMGFAQNRLHELNHGSSKQVPSHMKAEL*

DNA
ATGGAGAACGAGCTGTTTATGAATGCAGGAGCTTCTTCGCATACGCCGGTTATGACGTCACCGTCTTCTTCGCCGGCGAT
GCTTAACTGGGTTTCAATGGAGACTCAGCCAGTGGACCCAAGTCTCGGTTGCAATCTGTTTTGGGAAAAGTCAACGGAAC
AGAGCATCTTCCATTCGGCTCTTAGCTCACTCGTCTCTTCTCCGACGCCGTCAAATTCTAACTTTTCCGGTGGAGAAAAT
GTCGTTATCAGAGAACTCATCGGGAGATTGAGTAACATCGGCGACATCTATGGAACTCCGGCGAGCAACGGAAACGTCTC
TGGCTCGTGTTACGCAACTCCGATGAGCTCTCCAACGCCTGGACGTATGATGGTGACGAAAACGACGATGCCGATAACAG
AATTTTCCGGCGATCCGGGATTCGCAGAGAGAGCGGCGAGGTTCTCGTGTTTCGGTAGCCGGAGTTTCAACGGCAGAACA
AACTCGCCGTTTCCGATTAATAACGAACAACCCGTCGCAACCAATGAGAAAATGCCACGTATATCAAGCAGCCCAGTTCT
TAAGCCTCTCGTGTCTCATGTTCCCGCCGGCGAATCGTCCGGTGAATATTCCCGGAAAAGAAAAGCAAAATCCAAACAGA
ATTCTCCTTCTACAGTTTCACCATCAAAGGAGATTGAAGAGAAGGAAGATTCTGATCCAAAGAGATGCAAAAAATCAGAA
GATAATGGAGACAAAACAAAATCAATTGATCCTTACAAAGATTACATTCATGTTCGAGCTCGACGAGGCCAAGCCACCGA
TAGTCATAGTCTCGCCGAACGAGTTCGAAGAGAGAAAATAAGCGAAAGAATGAAGCTGCTTCAAGATCTTGTCCCTGGTT
GCAACAAGGTTACTGGAAAAGCACTGATGTTAGATGAAATTATAAACTATGTCCAATCATTGCAACGACAAGTTGAGTTC
TTGTCGATGAAGTTATCGTCGGTGAACACCAGGCTGGACTTTAACATGGACGCTCTCTTGTCTAAGGATATATTTCCTTC
AAGCAACAATCTAATGCATCATCAACATGTACTTCAATTAGATTCTTCAGCAGAAACGTTATTGGGTGATCATCACAATA
ATAATTTGCGGCTGAACCCTGATATTTCTTGTAATAACATAATAAACCCTTCAGAAACTTCTGAAACTAGAAGCTTCATT
TCTCACTTACCAACACTTGCCCATTTCACTGACTCTATTTCTCAGTATTCAACATTTTCCGAAGATGATTTAACTAGCAT
TATTCAAATGGGTTTTGCGCAAAACCGGCTCCACGAATTAAACCATGGTTCATCAAAGCAAGTACCGTCGCACATGAAAG
CTGAACTTTGA