Details for Lyrate rockcress Locus 16035355

Position : sca2 ( 5`- 16606258 .. 16608268 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_476667 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16035355

Protein [Map View]
MGEHSPSQPSSQTHPQNQPESPNPETPNPIPPGTNDDDSASSAGVSGSIVSLTTIEAPRVTELGNVSSPPSKIPLRPRKI
RKLSPDDDASGNGDGFNPEHNLLATTSKPAVKSKLSQSRCVTVPRIHARSLTCEGELEAALHHLRSVDPLLASLIDIHPP
PTFETFHTPFLALIRSILYQQLAAKAGNSIYTRFVALCGGENGVVPENVLPLTPQQLRQIGVSGRKASYLHDLARKYQNG
ILSDSGIVNMDEKSLFTMLTMVNGIGSWSVHMFMINSLHRPDVLPVNDLGVRKGVQMLNAMEDLPRPSKMEQLCEKWRPY
RSVASWYMWRLIESKGTPPNAAAVTAGAALSFPQLEDIQQQQEEQHHQQQPQLMDPLNNVFSIGAWGQT*

DNA
ATGGGTGAACATTCACCTTCTCAACCATCGTCTCAAACTCATCCCCAAAATCAACCAGAATCACCCAATCCCGAAACCCC
TAATCCAATTCCACCGGGAACTAACGATGATGACTCCGCCTCATCCGCCGGAGTTTCTGGCTCAATCGTCTCATTAACCA
CCATTGAAGCACCACGAGTCACTGAATTAGGCAATGTATCGTCTCCACCTTCCAAAATCCCACTCCGTCCTCGAAAAATC
CGGAAACTTTCACCCGACGATGACGCTTCCGGTAACGGCGACGGATTCAATCCGGAGCATAACCTTTTGGCGACGACTTC
AAAACCGGCAGTGAAGAGTAAATTGTCACAGTCACGCTGTGTAACCGTGCCGAGAATCCACGCGAGGTCTCTAACCTGTG
AAGGCGAGCTTGAAGCAGCGCTTCACCATCTCCGAAGTGTTGATCCTCTGCTCGCGTCGTTAATTGACATTCACCCACCA
CCAACGTTCGAGACTTTTCATACTCCGTTCTTGGCTTTGATTCGAAGCATTCTTTATCAGCAGTTAGCAGCTAAGGCAGG
GAATTCAATCTACACCCGCTTCGTTGCCTTATGCGGCGGTGAAAACGGCGTCGTTCCAGAGAATGTATTGCCTTTAACAC
CTCAACAGCTTCGACAAATCGGTGTTTCCGGGCGTAAAGCCAGTTACCTTCATGATCTTGCTAGGAAATATCAAAATGGG
ATCTTGTCGGATTCTGGAATAGTGAATATGGATGAGAAATCTTTGTTCACCATGTTAACAATGGTGAATGGGATTGGCTC
ATGGTCAGTTCATATGTTTATGATAAACTCTCTTCATAGACCCGATGTGTTACCAGTTAATGATCTTGGTGTAAGGAAAG
GTGTGCAGATGCTTAATGCCATGGAGGATTTGCCTCGTCCATCGAAAATGGAGCAGCTTTGCGAGAAATGGCGTCCGTAT
AGATCAGTAGCGTCGTGGTACATGTGGCGGCTCATTGAATCTAAAGGTACACCACCGAATGCTGCGGCTGTGACGGCTGG
AGCTGCTCTTTCGTTTCCACAGTTGGAAGACATTCAACAACAACAAGAAGAACAACATCATCAACAACAGCCACAGCTTA
TGGACCCCCTTAATAATGTGTTCAGTATCGGGGCATGGGGCCAAACATAG