Details for Lyrate rockcress Locus 16035350

Position : sca3 ( 5`- 6080875 .. 6076586 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478870 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16035350

Protein [Map View]
MANSYLSNCANVMVERINTSQELVELCKGKSSSALLKRLKVALVTANPVLADAEQRAEHVREIKHWLTGIKDAFFQAEDV
LDELLTEALRRRVVAEAGGLGGLFQNLMAGRETIQKKIEPKMEKVVRLLEHHVKHIEVIGLKEYSETREPQWRQASRSRP
DDLPQGRVVGRVEDKLALVNLLLSDDEISTGKPTVISVVGMPGVGKTTLTEIVFNDNRVTEHFDVKMWISAGINFNVFTV
TKAVLQDITSSAVNTEDLPSLQIQLKKTLSGKRFLLVLDDFWSESDSEWESFQVAFTDAEEGSKIVLTTRSEIVSTVAKA
EKIYQMKLMTNEECWELISRFAFGNISVGSINQELEGIGKRIAEQCKGLPLAARAIASHLRSKPNPDDWYAVSKNFSSYT
NSILPVLKLSYDSLPAQLKRCFALCSIFPKGHIFDREELILLWMAIDLLYQPRSSRRLEDIGNDYLGDLVAQSFFQRLDI
TMTSFVMHDLMNDLAKAVSGDFCFRLEDDNIPEIPSTTRHFSFSRSQCDASVAFRSISGAEFLRTILPFNSPTSLESLQL
TEKVLNPLLHALSGLRILSLSHYQITNLPKSLKGLKLLRYLDLSSTKIKDLPEFVCTLCNLQTLLLSNCRDLTSLPKSIA
ELINLRFLDLVGTPLVEMPPGIKKLRSLQKLSNFAIGRLSGAGLHELKELSHLRGTLRISELQNVAFASEAKDAGLKRKP
FLDELILKWTVKGSGFVPGSFNALACDQKEVLRMLEPHPHLKTFCIESYQGGAFPKWLGDSSFFGIASVTLSSCNLCISL
PPLGQLPSLKYLSIEKFNILQKVGIDFFFGENNLSCVPFQSLQTLKFYGMPRWEEWICPELEGGIFPCLQKLIIQRCPSL
TKKFPEGLPSSTEVTISDCPLRAVAGGEHSSRRSLTNIPESPTSIPSMSRRELSSPTGNSKSDASTSAQPGFASSSQSND
DNEVTSTSSLSSLPKDRPLSQTQDFDQYETQLGSLPQHFEEPAVISARYSGYISDIPSSLSPYISRTSLLPDPKNEGSGL
LGSSRLSYQYQPYGKLSVRSPPSSDTDNKKLSQYDDETDMDYLKVTEISHLMELPQNIQSLHIDSCDGLTSLPENLTESN
PNLHELIIIACHSLESFPGSHPPTTLKTLYIRDCKKLDFAESLQPTRSYSQLEYLFIGSSCSNLVNFPLSLFPKLKSLSI
RDCESFKTFSIHAGLGDDRIALESLEIRDCPNLVTFPQGGLPTPKLSSMLLSNCKKLRALPEKLFGLTSLLSLFIVKCPE
IETIPGGGFPSNLRTLCISICDKLTPRIEWGLRDLENLRNLEIEGGNEDIESFPDEGLLPKGIISLRISRFENLKTLNRK
GFQDTKAIETMEINGCDKLQISIDEDLPPLSCLRISSCSLLSENFAEAETEFFKVLNIPHVEIDGEIFS*

DNA
ATGGCGAACTCCTATTTATCAAATTGTGCGAACGTGATGGTTGAACGGATTAATACTTCTCAAGAATTGGTCGAACTATG
TAAAGGAAAGTCCTCCAGTGCATTGCTGAAGAGATTGAAGGTTGCTTTGGTGACTGCGAACCCGGTGCTTGCGGATGCTG
AGCAGAGAGCAGAACATGTTCGGGAAATAAAACATTGGCTTACAGGAATCAAAGATGCTTTCTTCCAGGCAGAGGATGTC
CTTGATGAGTTGCTAACCGAAGCTTTGCGGAGAAGAGTAGTAGCTGAAGCAGGAGGCTTAGGAGGACTATTCCAGAATCT
CATGGCTGGTCGAGAAACCATCCAGAAAAAGATAGAACCAAAGATGGAAAAAGTAGTTAGACTGCTGGAACATCATGTGA
AACACATTGAAGTTATTGGATTGAAAGAATATAGCGAGACTCGAGAACCACAATGGAGACAAGCATCACGGTCAAGACCT
GATGATCTTCCACAAGGCAGAGTGGTCGGGCGAGTGGAAGATAAGCTAGCGTTAGTCAATTTGCTGCTTTCTGATGATGA
AATAAGCACTGGGAAACCAACTGTGATCTCCGTAGTTGGTATGCCAGGGGTTGGAAAGACTACCTTGACAGAGATAGTTT
TTAATGACAACAGGGTGACAGAACATTTTGATGTTAAAATGTGGATCTCTGCCGGGATAAACTTTAACGTCTTCACGGTT
ACGAAAGCCGTTCTGCAGGATATCACTTCAAGTGCAGTTAATACTGAGGATCTACCTTCACTTCAAATTCAGCTGAAGAA
AACACTCTCGGGGAAGAGATTTTTACTTGTTCTGGATGATTTTTGGTCTGAAAGTGATTCAGAATGGGAAAGTTTCCAGG
TCGCCTTTACTGATGCAGAGGAAGGAAGCAAGATTGTTCTAACCACACGAAGTGAAATTGTCTCCACAGTAGCAAAGGCT
GAAAAAATCTACCAAATGAAGTTGATGACTAATGAAGAATGTTGGGAGCTGATCTCTAGATTTGCATTTGGAAATATATC
AGTCGGTTCTATCAACCAAGAACTAGAAGGAATTGGCAAAAGGATTGCAGAACAGTGCAAGGGCTTGCCATTAGCTGCAC
GAGCCATTGCATCTCATCTCCGTTCAAAGCCAAATCCTGACGACTGGTATGCTGTATCAAAGAATTTCTCAAGCTACACC
AACAGTATCCTTCCAGTTCTTAAACTAAGCTATGACTCTCTTCCTGCTCAACTTAAGCGATGCTTTGCCCTCTGCTCAAT
ATTCCCCAAGGGTCATATTTTCGATAGGGAGGAATTAATACTCCTATGGATGGCAATAGACCTCTTATACCAACCAAGGA
GCAGCAGAAGATTGGAAGATATTGGAAATGATTACCTTGGTGATTTAGTTGCTCAATCTTTTTTTCAGAGATTGGATATC
ACCATGACGAGCTTTGTGATGCATGATCTTATGAATGATTTGGCAAAAGCTGTTTCAGGAGATTTTTGTTTCAGACTGGA
AGATGACAACATTCCGGAGATACCAAGCACAACTCGACATTTTTCGTTTTCTAGAAGCCAATGTGATGCTTCCGTGGCTT
TCAGGTCCATCTCTGGAGCTGAGTTTCTGAGAACCATTCTTCCGTTCAACTCGCCAACAAGTCTTGAATCTCTCCAACTA
ACAGAAAAAGTTTTGAATCCTTTGCTCCATGCATTGAGCGGCCTACGAATTCTTAGCTTGTCTCATTATCAGATAACCAA
CTTGCCTAAATCATTAAAAGGTTTGAAGCTGTTACGGTATCTAGATTTGTCAAGCACCAAAATAAAAGATCTCCCAGAGT
TTGTGTGTACTCTATGTAATCTGCAGACACTATTGTTGTCAAATTGTCGTGACCTCACAAGCCTGCCAAAAAGCATTGCC
GAACTCATCAATTTGCGCTTCCTTGATCTCGTTGGCACTCCTTTGGTAGAGATGCCACCAGGAATAAAAAAGCTGCGAAG
CTTGCAGAAGTTATCAAATTTTGCTATAGGAAGGCTGAGTGGTGCCGGGCTGCATGAGCTCAAAGAACTTTCTCATCTCC
GAGGGACACTTCGCATCTCTGAGCTACAAAATGTGGCTTTTGCCTCAGAAGCAAAAGACGCTGGTTTGAAAAGAAAGCCA
TTCCTTGACGAGTTAATCCTGAAGTGGACTGTCAAAGGTTCTGGCTTCGTCCCTGGTAGTTTTAATGCATTGGCCTGTGA
CCAGAAAGAGGTCCTAAGGATGCTAGAACCCCATCCACACTTGAAAACGTTCTGCATTGAATCTTATCAGGGTGGAGCAT
TTCCGAAGTGGTTGGGCGATTCTTCATTCTTCGGTATTGCGTCCGTCACTCTCAGTAGCTGCAACCTCTGCATATCACTG
CCTCCACTGGGGCAGTTGCCTTCACTCAAGTATCTCAGCATTGAAAAATTTAACATTCTGCAGAAGGTTGGTATAGACTT
CTTCTTCGGTGAGAACAACCTTAGCTGTGTACCGTTTCAATCCTTGCAAACTCTAAAGTTCTATGGCATGCCAAGATGGG
AAGAATGGATTTGTCCGGAACTAGAAGGTGGGATCTTTCCTTGCCTCCAAAAACTCATAATACAAAGATGCCCCAGCTTA
ACAAAAAAATTTCCAGAAGGACTCCCTTCTTCCACTGAAGTCACCATCTCTGATTGTCCCCTAAGAGCAGTTGCTGGAGG
AGAACATTCCTCCAGAAGGAGTCTGACAAATATTCCAGAAAGTCCAACCAGCATTCCCTCTATGAGCAGAAGGGAACTGT
CTTCCCCTACAGGGAATTCAAAATCTGATGCAAGTACCAGTGCTCAGCCAGGTTTTGCTTCAAGTAGTCAAAGTAATGAT
GACAATGAAGTAACTTCGACATCAAGCTTGTCATCTTTGCCAAAGGATCGTCCACTGTCACAAACACAAGATTTCGACCA
ATATGAAACTCAACTTGGAAGCTTACCTCAGCATTTTGAAGAACCTGCAGTGATCTCGGCAAGATACTCAGGATATATCT
CGGATATACCTAGCTCGTTAAGTCCGTATATATCAAGAACATCACTTCTTCCAGATCCCAAAAATGAAGGTTCAGGTCTT
CTTGGAAGTAGTAGGCTTAGCTACCAGTACCAGCCATATGGAAAGCTTTCTGTTCGGAGTCCACCATCAAGTGATACAGA
TAACAAAAAGCTTTCACAATATGATGATGAAACAGACATGGACTATTTGAAAGTGACAGAGATCTCTCACCTCATGGAGC
TTCCTCAAAATATACAGTCACTCCACATCGACAGCTGCGATGGACTCACTTCCTTACCGGAGAACTTAACAGAAAGCAAT
CCAAATCTCCATGAACTGATCATCATTGCTTGTCACTCTCTAGAATCTTTCCCTGGAAGCCACCCTCCAACCACATTGAA
AACCTTATACATAAGAGACTGCAAGAAACTAGATTTCGCAGAGAGTTTGCAGCCAACACGAAGTTACTCACAGCTCGAAT
ACCTGTTCATCGGAAGTAGCTGCAGCAATCTCGTCAACTTCCCTCTCTCCTTGTTTCCGAAGCTGAAAAGCCTCTCGATT
AGGGATTGTGAAAGCTTCAAAACTTTCTCAATTCACGCAGGACTTGGAGACGATCGTATCGCTCTCGAGTCTCTTGAAAT
TAGGGATTGTCCAAATCTGGTAACTTTCCCACAAGGAGGACTTCCAACACCGAAACTCTCTTCAATGTTACTCTCTAACT
GCAAAAAGCTCCGAGCTTTACCGGAGAAATTGTTCGGACTCACTTCTCTCTTGTCACTGTTTATAGTCAAATGCCCAGAA
ATCGAGACGATCCCAGGTGGAGGGTTTCCGAGTAATCTCCGAACACTTTGCATCAGCATTTGCGACAAGCTTACACCGAG
AATCGAATGGGGATTGAGAGATTTGGAAAATCTTCGAAATCTTGAGATTGAAGGAGGTAACGAAGACATTGAATCGTTTC
CAGATGAAGGGTTATTGCCAAAAGGGATTATTTCTCTGAGGATTAGTCGTTTCGAGAACCTCAAGACTCTGAATCGAAAA
GGGTTTCAAGATACAAAAGCTATTGAGACGATGGAGATCAACGGCTGTGATAAGCTACAGATATCGATAGATGAAGATCT
TCCTCCTTTGTCTTGTTTGAGAATAAGCTCATGTTCATTGTTGTCTGAGAATTTTGCTGAAGCAGAAACAGAGTTCTTCA
AGGTTTTGAACATTCCACATGTGGAAATTGACGGCGAGATCTTCTCTTGA