Details for Lyrate rockcress Locus 16035281

Position : sca1 ( 5`- 7688478 .. 7687001 -3` )
Annotation : [B2G] early-phytochrome-responsive1 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16035281

Protein [Map View]
MAAEDRSEELSSNVENGSCNSNEGTNPETSSHWIENIVKVRKPYTVTKQREKWSEEEHDRFLEAIKLYGRGWRQIQEHIG
TKTAVQIRSHAQKFFSKMAQEPDNRSEGSVKAVVIPPPRPKRKPAHPYPRKSPVPYSQSPSSNLSAMEKGTKSPTSVLSS
FASEDQINRCSSPNSCTSDIQSIGATSIDKKNDYTTSKQSFKEDSDIGSIPMSSITLFGKIVLVVAESHDKPSSYRDDDD
PKSMTDQENHYSGIKNSSLHIDTNLSLGVWETSCTSSNAFGSVTEVSENLEKSAEPISCSWKQLSSLENQGSCNPATASG
FRPYKRCLSEREVTSSLSLVASEEQNSQRRARIC*

DNA
ATGGCCGCTGAGGATCGAAGTGAGGAGCTTAGCAGCAATGTAGAAAATGGAAGTTGCAATTCCAATGAAGGAACAAATCC
TGAAACCAGCAGTCATTGGATTGAAAACATTGTCAAGGTTAGGAAACCGTACACAGTAACTAAGCAGAGAGAGAAGTGGA
GTGAGGAAGAGCATGATAGGTTTCTTGAAGCTATTAAGCTTTATGGTCGTGGTTGGCGTCAAATCCAAGAACACATAGGT
ACGAAAACCGCTGTACAGATACGAAGCCATGCTCAAAAGTTTTTCTCCAAGATGGCTCAGGAACCTGACAATAGAAGTGA
AGGGTCGGTTAAAGCGGTTGTGATCCCGCCCCCTCGTCCAAAGAGAAAACCGGCACATCCTTATCCCCGGAAATCGCCTG
TTCCATATTCTCAGTCTCCTTCATCAAATTTGTCAGCTATGGAGAAAGGAACCAAGTCTCCAACTTCAGTCCTGTCATCA
TTTGCTTCAGAGGATCAAATCAATAGATGCTCTTCGCCTAATTCGTGTACCAGTGACATCCAATCCATTGGTGCAACTTC
CATTGATAAAAAGAATGACTACACAACATCCAAGCAATCCTTCAAAGAGGATTCTGACATTGGTTCAATACCCATGTCAA
GCATTACCCTTTTTGGGAAGATTGTCCTTGTCGTGGCAGAATCTCATGACAAACCATCCTCTTACAGAGATGATGATGAT
CCCAAATCAATGACAGATCAGGAGAATCACTACTCAGGGATCAAGAATTCTAGCTTGCATATTGATACTAATTTATCTCT
TGGGGTATGGGAAACGTCTTGTACCAGTTCTAATGCCTTTGGCTCAGTTACAGAAGTGTCAGAGAACTTGGAGAAGAGTG
CAGAGCCGATAAGTTGTTCATGGAAACAGTTGAGCTCCTTAGAAAACCAAGGATCATGTAATCCTGCAACTGCAAGTGGG
TTCAGGCCATACAAGAGATGCCTATCAGAAAGAGAAGTCACATCATCATTGTCGCTGGTAGCTTCAGAAGAACAGAACAG
CCAAAGAAGAGCACGTATATGCTAG