Details for Lyrate rockcress Locus 16035266

Position : sca3 ( 5`- 10596875 .. 10598102 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16035266

Protein [Map View]
MEKTQESVVRYGRKIEKMPFLMPAGRVVFATAFIVSAWREYYGFGVAADELRPKLGFFENQAKYIVSLGIMMKFIGGILF
IFNTYLGASPFLVYQAILSPILYDFYNRDFDRDHFTIFYTKFKEFVNETVSADDGVAMSLYTSMVNEESRQKFCDQLNEI
ARLAISNPLFTPSEFNTLFIRFIKGVGIVAALACFMAMKHRHGVLIKKTSKKQKT

DNA
ATGGAGAAAACCCAAGAATCGGTGGTTAGATATGGAAGAAAGATAGAGAAAATGCCGTTTCTTATGCCTGCCGGTCGAGT
TGTCTTTGCAACTGCGTTCATCGTGTCTGCTTGGAGAGAGTATTATGGTTTCGGAGTAGCTGCCGATGAGTTAAGACCAA
AACTTGGTTTCTTTGAGAACCAGGCAAAGTACATAGTTTCTCTTGGTATAATGATGAAGTTTATTGGAGGGATCTTATTC
ATCTTCAACACCTACCTAGGAGCTTCGCCTTTTCTTGTATACCAAGCCATTTTGAGTCCGATATTGTACGATTTCTACAA
TCGCGATTTTGATAGAGACCATTTCACCATTTTCTACACAAAGTTCAAAGAGTTTGTGAATGAGACGGTGTCAGCAGATG
ATGGAGTGGCCATGAGCCTCTATACCTCTATGGTTAACGAAGAATCGCGCCAGAAATTCTGCGATCAGCTTAACGAGATT
GCAAGACTAGCCATCTCGAATCCTCTATTCACACCAAGCGAGTTTAACACATTGTTCATTAGGTTTATTAAGGGTGTTGG
AATAGTAGCTGCATTGGCGTGCTTCATGGCGATGAAACATAGGCATGGGGTGCTCATCAAGAAGACGTCCAAGAAGCAAA
AAACTAA